Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD40 Proteins

Invitrogen

Human CD40 (aa 107-190) Control Fragment Recombinant Protein

View all (10) CD40 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD40 (aa 107-190) Control Fragment Recombinant Protein

Product Details

RP-95265

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Shipping conditions

Wet ice

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111025. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD40 is a single-chain glycoprotein and a member of the tumor necrosis factor receptor (TNFR) family, exhibiting significant homology to the Hodgkin's disease-associated antigen, CD30. It is expressed by B lymphocytes, follicular dendritic cells, thymic epithelium, and a subset of peripheral T cells, as well as some epithelial cells, carcinomas, and lymphoid dendritic cells. Notably, CD40 is present on all B cells except plasma cells. CD40 plays a crucial role in regulating B cell development and maturation, inducing immunoglobulin isotype-switching, and protecting B cells from surface Ig-induced apoptosis when combined with other signals such as IL-4. It promotes proliferation and is essential for T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. The interaction between CD40 and its ligand CD154 (gp39) on T cells is vital for T-B cell crosstalk, costimulation, and immune regulation. Adaptor protein TNFR2 interacts with CD40, mediating signal transduction, while the AT-hook transcription factor AKNA is reported to regulate CD40 expression, which may be important for homotypic cell interactions. Additionally, the interaction between CD40 and its ligand is necessary for amyloid-beta-induced microglial activation, suggesting a role in the early pathogenesis of Alzheimer's disease. Two alternatively spliced transcript variants encoding distinct isoforms of CD40 have been identified. Diseases associated with CD40 dysfunction include Type 3 Hyper-IgM immunodeficiency and CD40 ligand deficiency, highlighting its importance in immune and inflammatory responses.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: B cell surface antigen CD40; B cell-associated molecule; B-cell surface antigen CD40; Bp50; CD antigen CD40; CD40; CD40 molecule, TNF receptor superfamily member 5; CD40L receptor; CDw40; Immunoglobulin M; ImmunoglobulinM; MGC9013; sCD40; soluble CD40; Tumor necrosis factor receptor superfamily member 5

View more View less

Gene Aliases: Bp50; CD40; CDW40; p50; TNFRSF5

View more View less

UniProt ID: (Human) P25942

View more View less

Entrez Gene ID: (Human) 958

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5c796d7db4-nk9d7:80/100.66.128.142:80.
git-commit: d3b3aa98da0ae1b146c174fddb0766cfa6979daf
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0