Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • p23 Proteins

Invitrogen

Human p23 (aa 91-153) Control Fragment Recombinant Protein

View all (2) p23 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human p23 (aa 91-153) Control Fragment Recombinant Protein

Product Details

RP-97667

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

KERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDD

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83434. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Steroid receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Prior to activation, steroid receptors associate with a number of different proteins in both a stable and transient fashion. Steroid receptor complex proteins include heat shock proteins (HSP70 and HSP90), immunosuppressant binding proteins called immunophilins (the FK506 binding proteins, FKBP52 & FKBP54 and the cyclosporin binding protein, CyP-40) and at least three other proteins termed p23, p60 and p48. p23 along with HSP70, HSP90 and p60, combine with progesterone receptor (PR) as members of a transient intermediate complex. Cloned human p23 encodes a protein of 160 amino acids that is highly conserved between species and shows no homology to previously identified proteins. p23 is a highly acidic phosphoprotein with an aspartic acid-rich C-terminal domain and multiple potential phosphorylation sites. In vitro studies have suggested that p23 binds to HSP90 and is necessary for the binding of HSP90 and CyP-40 to PR. While neither its exact function nor mechanism of action have been identified, p23 appears to be an important factor in PR function.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Co chaperone p23; cPGES; cytosolic prostaglandin E synthase; Cytosolic prostaglandin E2 synthase; Hsp90 co chaperone; Hsp90 co-chaperone; Progesterone receptor complex p23; Prostaglandin E synthase 3; prostaglandin E synthase 3 (cytosolic); Telomerase-binding protein p23; unactive progesterone receptor, 23 kD

View more View less

Gene Aliases: cPGES; P23; PTGES3; TEBP

View more View less

UniProt ID: (Human) Q15185

View more View less

Entrez Gene ID: (Human) 10728

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-585975bbdc-prtps:80/100.66.134.196:80.
git-commit: a17be567db00e29ba041ba55be3678c43488a11a
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0