Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • beta Catenin Proteins

Invitrogen

Human beta Catenin (aa 663-755) Control Fragment Recombinant Protein

View all (2) beta Catenin proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human beta Catenin (aa 663-755) Control Fragment Recombinant Protein

Product Details

RP-95298

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

SEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPD

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Beta-catenin, an adherens junction (AJ) protein, was originally identified as a component of cell-cell adhesion structures. AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. Beta-catenin interacts with the cytoplasmic domain of E-cadherin and links E-cadherin to alpha-catenin, which in turn mediates anchorage of the E-cadherin complex to the cortical actin cytoskeleton. Studies show that Beta-catenin also binds to another cytoskeletal complex containing the adenomatous polyposis coli protein and microtubules, and interacts with several signaling pathways that include tyrosine kinases, phosphatases and Wnt/Wingless. The interplay between beta-catenin, cytoskeletal complexes and signaling pathways may regulate morphogenesis. Beta-catenin is expressed in several hair follicle cell types, basal and peripheral matrix cells, and cells of the outer and inner root sheats. A pathological role of beta-catenin has been identified in pilomatrixoma (PTR), medulloblastoma (MDB), colorectal cancer (CRC), ovarian cancer, and tumor development. In the nucleus, beta-catenin serves to co activate a family of Lef/Tcf transcription factors that stimulate transcription of target genes including those encoding cyclin D and c-myc that promote cell proliferation. The influence on cell proliferation is the molecular basis for the role of beta-catenin in tumorgenesis, specifically, solid tumors of the breast, colon, liver, lung, gastric, prostate, and skin.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Bcatenin; beta 1 88kDa; Beta-catenin; Betacatenin; C20orf33; Cadherin associated protein; catenin; catenin (cadherin-associated protein), beta 1; catenin (cadherin-associated protein), beta 1, 88kDa; Catenin b 1; Catenin b1; Catenin beta-1; Catenin beta1; Catenin β 1; Catenin β1; CTNB1; dJ633O20.1; DKFZp686D02253; FLJ25606; FLJ37923; NAP; NYD-SP19; OTTHUMP00000209289; P14L; PP8304; RP5-1118M15.1; β catenin; βcatenin

View more View less

Gene Aliases: armadillo; CTNNB; CTNNB1; MRD19; OK/SW-cl.35; PRO2286

View more View less

UniProt ID: (Human) P35222

View more View less

Entrez Gene ID: (Human) 1499

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0