Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • TAOK1 Proteins

Invitrogen

Human TAOK1 (aa 895-997) Control Fragment Recombinant Protein

View all (2) TAOK1 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human TAOK1 (aa 895-997) Control Fragment Recombinant Protein

Product Details

RP-89799

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

LSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSH

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

TAOK1 is a serine/threonine-protein kinase involved in regulation of the p38-containing stress-responsive MAP kinase pathway and extracellular signal-regulated protein kinase (ERK) kinases (MEKs). The activation of and binding to MEK3 by TAOK1 implicates TAOK1 in the regulation of the p38-containing stress-responsive MAP kinase pathway. A microtubule affinity-regulating kinase, TAOK1 (also known as MARKK) is an important regulator of mitotic progression, required for both chromosome congression and checkpoint-induced anaphase delay. TAOK1 is involved in various processes such as p38/MAPK14 stress-activated MAPK cascase, DNA damage response, and regulations of cytoskeleton stability. It phosphorylates MAP2K3, MAP2K6, and MARK2. TAOK1 acts as an activator of the p38/MAPK cascade by mediating phosphorylation and subsequent activation of the upsteam MAP2K3 and MAP2K6 kinases. It is involved in G-protein couples receptor signaling to p38/MAPK14. In response to DNA damage, TAOK1, is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade by phosphorylaton of MAP2K3 and MAP2K6. In addition, it acts as a regulator of cytoskeleton stability and a regulator of apoptosis.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: FLJ14314; h hTAOK1; H KIAA1361; hKFC-B; Kinase from chicken homolog B; MARK Kinase; MARKK; microtubule affinity regulating kinase kinase; prostate-derived STE20-like kinase 2; Prostate-derived sterile 20-like kinase 2; PSK-2; serine/threonine protein kinase TAO1 homolog; Serine/threonine-protein kinase TAO1; STE20-like kinase PSK2; tao; TAOK1; thousand and one amino acid protein 1; Thousand and one amino acid protein kinase 1

View more View less

Gene Aliases: hKFC-B; hTAOK1; KFC-B; KIAA1361; MAP3K16; MARKK; PSK-2; PSK2; TAO1; TAOK1

View more View less

UniProt ID: (Human) Q7L7X3

View more View less

Entrez Gene ID: (Human) 57551

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5f5c96ff6c-st5hm:80/100.66.129.203:80.
git-commit: 945c3ce0b94337c0c8e9574aed9898c23d0d1109
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.1-2025.09.37-1.0