Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • PI16 Proteins

Invitrogen

Human PI16 (aa 197-285) Control Fragment Recombinant Protein

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human PI16 (aa 197-285) Control Fragment Recombinant Protein

Product Details

RP-100425

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

CEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVT

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Peptidase inhibitor 16 (PI16), also known as CRISP-9 or PSPBP, is a member of the cysteine-rich secretory protein (CRISP) family and plays a significant role in various biological processes. This protein consists of 436 amino acids and features three N-linked glycosylation motifs, suggesting its localization to the plasma membrane through a GPI anchor. PI16 has been implicated as a binding protein for prostate secretory protein of 94 amino acids (PSP94), which reflects its potential involvement in reproductive biology. Recent findings highlight PI16's expression in fibroblasts, particularly marking a precursor fibroblast cell state, which is critical in fibroblast lineage development. This expression is heightened in certain pathological conditions, such as neuropathic pain and inflammatory arthritis. In neuropathic pain models such as the spared nerve injury (SNI) model, elevated PI16 levels are noted in fibroblasts within the dorsal root ganglia (DRG) and sciatic nerve, but not in neurons or glia. Interestingly, mice lacking PI16 are protected against neuropathic pain, indicating its role in enhancing pain signaling. Conversely, in rheumatoid arthritis (RA), PI16's overexpression in peripheral blood and synovial fluid correlates with worsened arthritis severity, partly by suppressing the expression of the regulatory T cell marker Foxp3. This complex role of PI16, affecting various signaling pathways and cellular states, underscores its potential as a therapeutic target in pain and inflammatory diseases.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: CD364; CRISP-9; Cysteine-rich secretory protein 9; microseminoprotein, beta-binding protein; Peptidase inhibitor 16; PI-16; protease inhibitor 16; PSP94-binding protein

View more View less

Gene Aliases: CD364; CRISP9; MSMBBP; PI16; PSEC0164; PSPBP; UNQ289/PRO328

View more View less

UniProt ID: (Human) Q6UXB8

View more View less

Entrez Gene ID: (Human) 221476

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-56ffd697dc-88d4p:80/100.66.130.94:80.
git-commit: 082a6d415be982b1f92c35e55dd71609d4576d3e
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.1-2025.09.37-1.0