Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • PGP9.5 Proteins

Invitrogen

Human PGP9.5 (aa 73-219) Control Fragment Recombinant Protein

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human PGP9.5 (aa 73-219) Control Fragment Recombinant Protein

Product Details

RP-101892

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Shipping conditions

Wet ice

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

PGP9.5 (Protein gene product 9.5, UCH-L1, PARK5) is a neuron specific protein, structurally and immunologically distinct from neuron specific enolase. PGP9.5 has a molecular weight of 27 kDa and was first identified by high resolution two dimensional PAGE. PGP9.5 is a member of ubiquitin carboxyl-terminal hydrolase family 1 (peptidase family C12) with a ubiquitin carboxyl-terminal hydrolase domain. PGP9.5 is well known for having ubiquitin hydrolase and ligase activities that hydrolyzes small C-terminal adducts of ubiquitin to generate ubiquitin monomers. PGP9.5 is present in neurons and nerve fibers at all levels of the central and peripheral nervous system, in neuroendocrine cells, in segments of the renal tubules, in spermatogonia and Leydig cells of the testis, in ova and in some cells of both the pregnant and non-pregnant corpus luteum. Over expression of PGP9.5 leads to non-small cell lung cancer while decreased expression leads to Huntington disease and Alzheimer disease. Since PGP9.5 is present in cellular inclusions, it can be a useful as a neuronal marker and in the studies of neurodegenerative disorders such as with Parkinson disease.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: epididymis luminal protein 117; epididymis secretory protein Li 53; Neuron cytoplasmic protein 9.5; OTTHUMP00000218137; OTTHUMP00000218139; OTTHUMP00000218140; OTTHUMP00000218141; PGP 9.5; PGP9.5; ubiquitin C-terminal hydrolase; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); Ubiquitin carboxyl-terminal hydrolase isozyme L1; Ubiquitin thioesterase L1; ubiquitin thiolesterase; UCH-L1; UCHL

View more View less

Gene Aliases: HEL-117; HEL-S-53; NDGOA; PARK5; PGP 9.5; PGP9.5; PGP95; Uch-L1; UCHL1

View more View less

UniProt ID: (Human) P09936

View more View less

Entrez Gene ID: (Human) 7345

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0