Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD49b (Integrin alpha 2) Proteins

Invitrogen

Human ITGA2 (aa 770-858) Control Fragment Recombinant Protein

View all (2) CD49b (Integrin alpha 2) proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human ITGA2 (aa 770-858) Control Fragment Recombinant Protein

Product Details

RP-103515

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84600. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD49b (Integrin alpha 2, Integrin alpha 2 chain, VLA-2 alpha chain, HM alpha 2) is a member of the integrin family. It is a glycoprotein with molecular weight of 150 kD, and it complexes with CD29 (Integrin beta 1) to form the heterodimeric integrin VLA-2 (integrin alpha 2 beta 1, or GPIa/IIa) complex. VLA-2 is an extracellular receptor for laminin, collagen, and fibronectin, and interaction with its ligands results in the activation of intracellular signaling pathways. It has reported roles in VEGF-induced angiogenesis in vivo, as well as adhesion and lymphocyte activation. CD49b is expressed by NK cells, NK-T cells, monocytes, platelets, and epithelial cells. It is also expressed on adaptive immune cells such as T and B cells, specifically on a subset of CD4+ T cells in the spleen, on intraepithelial and lamina propria lymphocytes in the intestine, as well as on a population of peripheral CD4+ type 1 T regulatory (Tr1) cells that co-express LAG-3.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: alpha 2 subunit of VLA-2 receptor; BDPLT9; CD49 antigen-like family member B; CD49b; Collagen receptor; GPIa; human platelet alloantigen system 5; Integrin alpha-2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); platelet antigen Br; platelet glycoprotein GPIa; Platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; VLA-2 subunit alpha; VLA2 receptor

View more View less

Gene Aliases: BR; CD49B; GPIa; HPA-5; ITGA2; VLA-2; VLAA2

View more View less

UniProt ID: (Human) P17301

View more View less

Entrez Gene ID: (Human) 3673

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-hqqk4:80/100.66.128.142:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0