Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • IGF1 Proteins

Invitrogen

Human IGF1 (aa 96-153) Control Fragment Recombinant Protein

View all (8) IGF1 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human IGF1 (aa 96-153) Control Fragment Recombinant Protein

Product Details

RP-101096

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

IGF1 (Insulin-like growth factor-1) is structurally and functionally related to insulin but has a much higher growth-promoting activity. A variety of cellular responses are induced by IGF1, including cell proliferation, differentiation, migration, and survival. Further, IGF1 is a polypeptide growth factor that stimulates the proliferation of a wide range of cell types in muscle, bone, and cartilage tissue. IGF1 stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regards to enhancing glucose uptake. In circulation, IGFs are predominantly bound to binding proteins (IGFBPs) which prolong the half-life of the IGFs and play a role in delivering them to target tissues. IGF-I is known as one of the most potent activators of the AKT signaling pathway which is known to be a stimulator of proliferation and an inhibitor of programmed cell death. Moreover, mature human IGF-I is 100% homologous with bovine and porcine proteins. Low levels of IGF1 have been linked to Alzheimer's disease. IGF1 is processed from a precursor, bound by a specific receptor, and secreted. Defects in the IGF1 gene are a cause of insulin-like growth factor 1 deficiency and several transcript variants encoding different isoforms have been found.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: H-IGF-1; IGF; IGF-I; IGF-IA; IGF-IB; IGF1A; IGFIa; Insulin like growth factor; Insulin-like growth factor 1; insulin-like growth factor 1 (somatomedin C); Insulin-like growth factor I; insulin-like growth factor IB; M-IGF-1; Mechano growth factor; MGF; OTTHUMP00000195084; R-IGF-1; Somatomedin C; Somatomedin-C

View more View less

Gene Aliases: IBP1; IGF-1; IGF-I; IGF1; IGFI; MGF

View more View less

UniProt ID: (Human) P05019

View more View less

Entrez Gene ID: (Human) 3479

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-7656545596-c6hgs:80/100.66.131.58:80.
git-commit: e4c03c1a377eb120fb9d3a6f199e7b4f6022db68
git-url: https://github.com/thermofisher/magellan-search
git-branch: feature/2.37.0/CFGMAGJ/CFGMAGJ-5955/CFGMAGJ-5981-ZRP_Analytics_spellcheck_cross_search