Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • DRAK2 Proteins

Invitrogen

Human DRAK2 (aa 2-42) Control Fragment Recombinant Protein

View all (4) DRAK2 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human DRAK2 (aa 2-42) Control Fragment Recombinant Protein

Product Details

RP-109796

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

SRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRG

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145039. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

STK17B (also known as DRAK2) is a member of the serine/threonine kinase family and is related to death-associated protein kinase that triggers apoptosis. STK17B is selectively important for T-cell survival and inhibition of STK17B has therapeutic potential for autoimmune disease. T-cell survival depends on a balance of T-cell receptor and co-stimulatory signals and deficiency of STK17B can affect autoimmune disease susceptibility without generalized suppression of the immune system. Protein kinases play important roles in the signal transduction in response to a variety of external stimuli. Recently, several protein kinases have been identified that may also be involved in apoptotic process. Overexpression of a serine/threonine kinase, ZIP kinase can cause the morphological changes typical of apoptosis in NIH 3T3 cells. Sanjo et al, have identified two new protein kinases DRAK1 and DRAK2 (Death Receptor Associated Kinase 1 and 2). Both DRAKs and ZIP kinase share significant homology at the amino acid level. The kinase domains of both DRAKs, ZIP kinase are homologous to DAP (Death-associated protein) kinase, which is involved in the apoptotic signaling induced by interferon-g. Overexpression of DRAKs in NIH 3T3 cells lead to apoptosis. These transfection experiments suggest that C-terminal domain of DRAKs are important for induction of apoptosis.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: DAP kinase-related apoptosis-inducing protein kinase 2; death-associated protein kinase-related 2; DRAK 2; Serine/threonine-protein kinase 17B; ST17B; STK 17B

View more View less

Gene Aliases: DRAK2; STK17B

View more View less

UniProt ID: (Human) O94768

View more View less

Entrez Gene ID: (Human) 9262

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-585975bbdc-jwj8f:80/100.66.129.203:80.
git-commit: a17be567db00e29ba041ba55be3678c43488a11a
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0