Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CYP2D6 Proteins

Invitrogen

Human CYP2D6 (aa 196-273) Control Fragment Recombinant Protein

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CYP2D6 (aa 196-273) Control Fragment Recombinant Protein

Product Details

RP-100044

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

1.19 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Shipping conditions

Wet ice

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83766. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Cholesterol 25-hydroxylase; CYPIID6; Cytochrome P450 2D6; cytochrome P450, family 2, subfamily D, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1; Cytochrome P450-DB1; Debrisoquine 4-hydroxylase; flavoprotein-linked monooxygenase; microsomal monooxygenase; nonfunctional cytochrome P450 2D6; xenobiotic monooxygenase

View more View less

Gene Aliases: CPD6; CYP2D; CYP2D6; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID6; P450-DB1; P450C2D; P450DB1

View more View less

UniProt ID: (Human) P10635

View more View less

Entrez Gene ID: (Human) 1565

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-hqqk4:80/100.66.128.142:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0