Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD83 Proteins

Invitrogen

Human CD83 Control Fragment Recombinant Protein

View all (2) CD83 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD83 Control Fragment Recombinant Protein

Product Details

RP-110034

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

KFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPQKTELV

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD83 cell surface antigen is a 40-45kD glycoprotein expressed by peripheral blood dendritic cells. Peripheral lymphocytes can be induced to express very low levels of CD83 after culture in agents such as Con A or PHA. In immunohistology, CD83 is shown to be expressed strongly by interfollicular interdigitating reticulum cells and more weakly by cells within germinal centres. CD83 is also expressed by Langerhan's cells in the skin. The CD83 antigen is a 186-amino-acid single-chain glycoprotein and this molecule is a member of the immunoglobulin superfamily that is composed of an extracellular V-type Ig-like single domain, a transmembrane region, and a short, 40-amino-acid cytoplasmic tail. CD83 antigen undergoes extensive post-translational glycosylation, since the determined Mr is twice the predicted size of the core protein. However, CD83+ cells have a unique cell surface immuno-phenotype that does not correlate with that of T cells, B cells, NK cells, or cells of the myelomonocytic lineage. CD83+ cells coexpress the highest levels of MHC class II molecules, when compared with other leucocyte lineages. They also co-express T cell markers (CD2, CD5), B cell markers (CD40, CD78), myeloid cell markers (CD13, CD33, CD36), cytokine receptors as well as other cell surface molecules. Diseases associated with CD83 dysfunction include plague and Rift Valley Fever.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: B-cell activation protein; CD antigen CD83; CD83; CD83 antigen; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); Cell surface protein HB15; cell-surface glycoprotein; hCD83

View more View less

Gene Aliases: BL11; CD83; HB15

View more View less

UniProt ID: (Human) Q01151

View more View less

Entrez Gene ID: (Human) 9308

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0