Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD81 Proteins

Invitrogen

Human CD81 (aa 114-204) Control Fragment Recombinant Protein

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD81 (aa 114-204) Control Fragment Recombinant Protein

Product Details

RP-88747

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82288. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD81 (TAPA-1, target of anti-proliferative antibody-1) is a member of the tetraspanin family, is expressed on virtually all nucleated cells, but above all on germinal center B cells. CD81 forms complexes with other tetraspanin proteins, integrins, coreceptors, MHC class I and II molecules, and influences adhesion, morphology, activation, proliferation and differentiation of B, T cells. In muscles, CD81 promotes cell fusion and myotube maintenance. CD81 has been also identified as a receptor for the hepatitis C virus. Like members of the tetraspanin family that include CD9, CD37, CD53, CD63, and CD82, CD81 is a cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. CD81 is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. CD81 associates with CD19, CD21, Leu 13, and integrins on cell membrane and acts as a receptor for the envelope protein E2 of chronic hepatitis C virus. Antibodies to CD81 have anti-proliferative effects on different lymphoid cell lines, particularly those derived from large cell lymphomas. CD81 is also localized in the tumor-suppressor gene region and is a candidate gene for malignancies.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: 26 kDa cell surface protein TAPA-1; CD81; CD81 antigen; CD81 antigen (target of antiproliferative antibody 1); Target of the antiproliferative antibody 1; Tetraspanin-28; Tetraspanin28; Tspan-28

View more View less

Gene Aliases: CD81; CVID6; S5.7; TAPA1; TSPAN28

View more View less

UniProt ID: (Human) P60033

View more View less

Entrez Gene ID: (Human) 975

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0