Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD8 Proteins

Invitrogen

Human CD8 (aa 64-147) Control Fragment Recombinant Protein

View all (20) CD8 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD8 (aa 64-147) Control Fragment Recombinant Protein

Product Details

RP-96569

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD8, also known as cluster of differentiation 8, is a type I transmembrane glycoprotein of the immunoglobulin family that plays a crucial role in T cell differentiation, activation, and signal transduction. It is expressed as either a heterodimer (CD8 alpha beta) or a homodimer (CD8 alpha alpha). The CD8 alpha beta form is predominantly found on the majority of thymocytes and a subpopulation of mature alpha beta TCR T cells, while the CD8 alpha alpha form is expressed on gamma delta TCR T cells, a subset of intestinal intraepithelial lymphocytes (IELs), and dendritic cells. CD8 functions as a co-receptor for major histocompatibility complex class I (MHC-I) molecules, working alongside the T cell receptor (TCR). The CD8 alpha chain is essential for binding to MHC-I. CD8 is also expressed on a subset of T cells, NK cells, monocytes, and dendritic cells as disulfide-linked homodimers of CD8 alpha. Upon ligation of MHC-I/peptide complexes presented by antigen-presenting cells (APCs), CD8 recruits lymphocyte-specific protein tyrosine kinase (Lck), leading to lymphokine production, increased motility, and activation of cytotoxic T lymphocytes (CTLs). Activated CTLs are vital for clearing pathogens and tumor cells. The differentiation of naive CD8+ T cells into CTLs is strongly enhanced by cytokines such as IL-2, IL-12, and TGF-beta1. Through its interactions with MHC-I and association with protein tyrosine kinase p56lck, CD8 plays a significant role in T cell development and the activation of mature T cells.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: CD8 antigen, alpha polypeptide (p32); CD8 antigen, beta polypeptide 1 (p37); CD8a; CD8alpha; CD8b; CD8beta; fCD8; Leu-2; leu-2a; Leu2 T-lymphocyte antigen; OKT8 T-cell antigen; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T-cell antigen Leu2; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T-cell antigen

View more View less

Gene Aliases: CD8; CD8A; CD8B; CD8B1; LEU2; LY3; LYT3; MAL; p32; P37

View more View less

UniProt ID: (Human) P01732, (Human) P10966

View more View less

Entrez Gene ID: (Human) 925, (Human) 926

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-hqqk4:80/100.66.128.142:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0