Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD59 Proteins

Invitrogen

Human CD59 (aa 28-104) Control Fragment Recombinant Protein

View all (2) CD59 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD59 (aa 28-104) Control Fragment Recombinant Protein

Product Details

RP-95098

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82921. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD59 (Protectin) is a small (18-20 kDa) GPI-anchored ubiquitously expressed inhibitor of the membrane attack complex (MAC). CD59 is the key regulator that preserves the autologous cells from terminal effector mechanism of the complement cascade. CD59 also associates with C5b-8 complex and counteracts appropriate formation of cytolytic pore within the plasma membrane. Further, CD59 is a low-affinity ligand of human CD2, causes T cell costimulation, and is involved in lymphocyte signal transduction. CD59 is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. Mutations in this gene cause CD59 deficiency, a disease involving hemolytic anemia, thrombosis, and cerebral infarction. Multiple alternatively spliced transcript variants of CD59 have been identified.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: 1F5 antigen; 20 kDa homologous restriction factor; CD59; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); CD59 glycoprotein; CD59 molecule, complement regulatory protein; HRF-20; human leukocyte antigen MIC11; Ly-6-like protein; lymphocytic antigen CD59/MEM43; MAC-inhibitory protein; MAC-IP; MACIF; MEM43 antigen; membrane attack complex (MAC) inhibition factor; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MIRL; Protectin; surface anitgen recognized by monoclonal antibody 16.3A5; T cell-activating protein

View more View less

Gene Aliases: 16.3A5; 1F5; CD59; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20

View more View less

UniProt ID: (Human) P13987

View more View less

Entrez Gene ID: (Human) 966

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0