Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD35 Proteins

Invitrogen

Human CD35 (aa 1490-1556) Control Fragment Recombinant Protein

View all (3) CD35 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD35 (aa 1490-1556) Control Fragment Recombinant Protein

Product Details

RP-99830

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83616. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD35 (CR1, Complement Receptor 1) is a cell membrane-bound, monomeric glycoprotein and its primary function is to serve as the cellular receptor for C3b and C4b, the most important components of the complement system leading to clearance of foreign macromolecules. CD35 protein mediates cellular binding to particles and immune complexes that have activated complement. The CD35 complex is four different allotypes (C,A,B,D) C is 160 kDa; A is 190 kDa; B is 220 kDa and D is 250 kDa. CD35 is involved in the processing of immune complexes, promoting of binding and phagocytosis of C3b complexes and inhibition of complement activation. CD35 is on neutrophils, eosinophils, monocytes, B-cells, some NK-cells, erythrocytes, myeloid leukemias, follicular dendritic reticulum cells and is negative on basophils. Decreases in expression of CD35 protein and/or mutations in its gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus and sarcoidosis. Mutations in the CD35 gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria. Alternate allele-specific splice variants encoding different isoforms of CD35 have been characterized. An additional secreted form of CD35 have also been described but has not been fully characterized.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: C3 binding protein; C3-binding protein; C3b/C4b receptor; CD35; CD35 antigen; complement component (3b/4b) receptor 1 (Knops blood group); Complement Component (3b/4b) receptor 1 including Knops blood group system; Complement receptor type 1; Knops blood group antigen

View more View less

Gene Aliases: C3BR; C4BR; CD35; CR1; KN

View more View less

UniProt ID: (Human) P17927

View more View less

Entrez Gene ID: (Human) 1378

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0