Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD235a (Glycophorin A) Proteins

Invitrogen

Human CD235a (aa 31-90) Control Fragment Recombinant Protein

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD235a (aa 31-90) Control Fragment Recombinant Protein

Product Details

RP-91039

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Glycophorin A, also known as CD235a, is a 151 amino acid sialoglycoprotein expressed on the membrane of mature erythrocytes and erythroid progenitor cells, with approximately 500,000 copies per cell. The gene for glycophorin A is located on chromosome 4 and exists in two allelic forms, M and N, which differ by two amino acids: the M group has Ser1 and Gly5, while the N group has Leu1 and Glu5. These allelic variations define the blood group M and N specificities. Glycophorin A serves multiple functions, including providing a mucin-like barrier that minimizes aggregation between red blood cells in circulation, potentially preventing cell fusion. It also acts as a receptor for certain pathogens, including Sandei virus, parvovirus, and Hsa, a Streptococcus adhesin. Recent studies suggest that exposure to toxins can lead to mutations or loss of alleles, resulting in phenotypic changes. There is ongoing research correlating genotype and phenotype with predisposition to diseases such as cancer and heart disease, highlighting the importance of glycophorin A in both health and disease. Glycophorin A is a significant marker for studying erythrocyte-related functions and pathologies, as well as its role in pathogen interactions and disease predisposition.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: CD235; CD235a; erythroid-lineage-specific membrane sialoglycoprotein; glycophorin A (MN blood group); glycophorin A, GPA; glycophorin Erik; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Sta type C; Glycophorin-A; HGNC:4702; HGpMiX; HGpStaC; Mi.V glycoprotein; Mi.V glycoprotein (24 AA); MN sialoglycoprotein; PAS-2; recombinant glycophorin A-B Miltenberger-DR; Sialoglycoprotein alpha

View more View less

Gene Aliases: CD235a; GPA; GPErik; GPSAT; GYPA; HGpMiV; HGpMiXI; HGpSta(C); MN; MNS; PAS-2

View more View less

UniProt ID: (Human) P02724

View more View less

Entrez Gene ID: (Human) 2993

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5c796d7db4-nk9d7:80/100.66.128.142:80.
git-commit: d3b3aa98da0ae1b146c174fddb0766cfa6979daf
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0