Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD23 Proteins

Invitrogen

Human CD23 (aa 185-308) Control Fragment Recombinant Protein

View all (4) CD23 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD23 (aa 185-308) Control Fragment Recombinant Protein

Product Details

RP-90049

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

VHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDP

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82370. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD23 is a 45 kDa glycoprotein that serves as a low-affinity receptor for IgE, playing a crucial role in regulating IgE responses and B cell activation. It is expressed on mature B cells, mantle zone B cells, follicular dendritic cells, and at lower levels on T cells, NK cells, Langerhans cells, and platelets. CD23 expression is upregulated upon B cell activation, and its soluble forms are biologically active, acting as potent mitogenic factors. CD23 is strongly expressed on Epstein-Barr virus (EBV)-transformed B lymphoblasts and is present on a subpopulation of freshly isolated peripheral blood and tonsil B cells. It is also detected in neoplastic cells from cases of B cell chronic lymphocytic leukemia and some centroblastic/centrocytic lymphomas. Functionally, CD23 is involved in B cell growth, differentiation, and IgE production. It interacts with CD21 and the alpha subunits of CD11b and CD11c, further influencing immune responses. Diseases associated with CD23 dysfunction include chronic conjunctivitis and chronic lymphocytic leukemia, highlighting its importance in both normal immune function and disease states. This makes CD23 a valuable target for antibody customers interested in B-cell-related research and diagnostics.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: BLAST-2; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; CD23; CD23 antigen; Fc epsilon receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); Fc-epsilon-RII; FceRII; Immunoglobulin E-binding factor; immunoglobulin epsilon-chain; Low affinity immunoglobulin epsilon Fc receptor; Lymphocyte IgE receptor

View more View less

Gene Aliases: BLAST-2; CD23; CD23A; CLEC4J; FCE2; FCER2; IGEBF

View more View less

UniProt ID: (Human) P06734

View more View less

Entrez Gene ID: (Human) 2208

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0