Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD206 (MMR) Proteins

Invitrogen

Human CD206 (aa 29-143) Control Fragment Recombinant Protein

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD206 (aa 29-143) Control Fragment Recombinant Protein

Product Details

RP-101913

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD206 (MSR, Mannose receptor, MRC1) is a 175 kDa transmembrane protein belonging to the group of pattern recognition receptors. CD206 is predominantly expressed in tissue macrophages, dendritic cells, a subpopulation of endothelial cells and sperm cells. CD206 is thought to play a role in the innate and adaptive immune response. CD206 is also expressed on microglia and mato cells of the brain but not astrocytes or neurons. CD206 also mediate the recognition and uptake of a variety of macromolecules, including modified lipoproteins, advanced glycation end (AGEs) products and amyloid b-protein (Abeta). While the normal role of CD206 is associated with cell adhesion and host defense mechanisms, it also has been implicated in the development of atherosclerosis and Amyloid beta deposition in Alzheimer's disease (AD). CD206's gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. CD206 has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. Other diseases associated with CD206 dysfunction include leprosy and Gaucher's Disease.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: C-type lectin domain family 13 member D; C-type lectin domain family 13 member D-like; CD206; hMR; Human mannose receptor; Macrophage mannose receptor 1; Macrophage mannose receptor 1-like protein 1; mannose receptor, C type 1-like 1; MMR

View more View less

Gene Aliases: bA541I19.1; CD206; CLEC13D; CLEC13DL; hMR; MMR; MRC1; MRC1L1

View more View less

UniProt ID: (Human) P22897

View more View less

Entrez Gene ID: (Human) 4360

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0