Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD18 Proteins

Invitrogen

Human CD18 Control Fragment Recombinant Protein

View all (8) CD18 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD18 Control Fragment Recombinant Protein

Product Details

RP-88639

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD18, also known as the integrin beta 2 subunit, is a 90-95 kDa type I transmembrane protein expressed on all leukocytes. It heterodimerizes with the alpha chains of CD11a, CD11b, CD11c, and CD11d to form various leukocyte (beta2) integrins, which are crucial for cellular adhesion and signaling. The CD18/CD11a complex, known as lymphocyte function-associated antigen-1 (LFA-1), plays a significant role in cellular adhesion and inflammatory reactions. CD18 also forms heterodimers with CD11b (Mac-1, CR3), CD11c, and CD11d, contributing to the processes of cell adhesion and cell-surface mediated signaling. These integrins are essential for proper leukocyte migration and mediating intercellular contacts. The absence of CD18 leads to leukocyte adhesion deficiency type I (LAD1), a condition characterized by impaired leukocyte migration. Severe reduction in CD18 expression can result in the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin, which can mediate leukotoxin-induced cytolysis. Defects in the CD18 gene are the cause of LAD1, and two transcript variants encoding the CD18 protein have been identified. The integrin-mediated responses are often a composite of the functions of its individual subunits, highlighting the importance of CD18 in immune function and disease.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: CD18; cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor); Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; complement component 3 receptor 3 and 4 subunit; complement receptor C3 beta-subunit; Complement receptor C3 subunit beta; integrin beta chain, beta 2; Integrin beta-2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C

View more View less

Gene Aliases: CD18; ITGB2; LAD; LCAMB; LFA-1; MAC-1; MF17; MFI7

View more View less

UniProt ID: (Human) P05107

View more View less

Entrez Gene ID: (Human) 3689

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5fc94fc45-4mbwj:80/100.66.130.94:80.
git-commit: 7a6627b71d15189168043ee5c63248cc100e5965
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0