Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • Apolipoprotein J Proteins

Invitrogen

Human Apolipoprotein J (aa 184-292) Control Fragment Recombinant Protein

View all (2) Apolipoprotein J proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human Apolipoprotein J (aa 184-292) Control Fragment Recombinant Protein

Product Details

RP-93716

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110616. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Aging associated protein 4; Aging-associated gene 4 protein; aging-associated protein 4; apo j; Apo J a; Apo J alpha; Apo J b; Apo J beta; Apo J α; Apo J β; Apo Ja; Apo Jb; Apo-J; ApoJ a; ApoJ alpha; ApoJ b; ApoJ beta; ApoJ α; ApoJ β; ApoJa; ApoJb; Apolipoprotein J; CLI; Clusterin; Clusterin alpha / beta chain; Complement associated protein SP40; Complement cytolysis inhibitor; complement lysis inhibitor; Complement-associated protein SP-40,40; GP80; HGNC:2095; Ku70-binding protein 1; Ku70-binding protein 1 (KUB1); MGC24903; NA1/NA2; SGP-2; Sulfated glycoprotein 2; Sulfated glycoprotein 2 (SGP2); Testosterone repressed prostate message 2 (TPRM2B); Testosterone-repressed prostate message 2; TRPM-2

View more View less

Gene Aliases: AAG4; APO-J; APOJ; CLI; CLU; CLU1; CLU2; KUB1; NA1/NA2; SGP-2; SGP2; SP-40; TRPM-2; TRPM2

View more View less

UniProt ID: (Human) P10909

View more View less

Entrez Gene ID: (Human) 1191

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-56ffd697dc-88d4p:80/100.66.130.94:80.
git-commit: 082a6d415be982b1f92c35e55dd71609d4576d3e
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.1-2025.09.37-1.0