Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • APE1 Proteins

Invitrogen

Human APE1 (aa 103-251) Control Fragment Recombinant Protein

View all (2) APE1 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human APE1 (aa 103-251) Control Fragment Recombinant Protein

Product Details

RP-88935

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

1M urea/PBS, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

Mammalian apurinic/apyrimidinic endonuclease (APE/ref-1) is a multifunctional, bipartite enzyme that plays an important role in numerous, cellular functions. APE is responsible for repairing abasic sites in DNA and in regulating the redox state of other proteins that play roles in oxidative signaling, transcription factor regulation (Fos, Jun, NF-kB, Myb, HIF-1 alpha, CREB, Pax), cell cycle control (p53), and apoptosis. The most common form of DNA damage is the creation of abasic sites which are brought about through spontaneous loss or oxidative DNA damage, through chemically initiated hydrolysis (chemotherapy), ionizing radiation, UV irradiation, oxidizing agents, and removal of modified bases by DNA glycosylases. APE is differentially expressed during development and in different tissues. This protein has diverse subcellular localization patterns which support the possibility of its interaction with numerous, other cellular proteins in addition to DNA repair within the nucleus. Regulation of APE by phosphorylation is mediated, at least in part, by casein kinase II. Increases in APE message and protein levels are observed upon the reintroduction of oxygen to hypoxic cells, and in some malignant tissue relative to normal tissue. Decreases in APE expression have been associated with the induction of cellular apoptosis.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: AP endonuclease 1; AP endonuclease class I; AP lyase; APEN; APEX nuclease; APEX nuclease (multifunctional DNA repair enzyme) 1; Apurinic-apyrimidinic endonuclease 1; apurinic/a; Apurinic/apy; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); DNA repair nuclease/redox regulator APEX1; DNA-(apurinic or apyrimidinic site) endonuclease; protein REF-1; redox factor 1; Redox factor-1; REF-1

View more View less

Gene Aliases: APE; APE1; APEN; APEX; APEX1; APX; HAP1; REF1

View more View less

UniProt ID: (Human) P27695

View more View less

Entrez Gene ID: (Human) 328

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-56ffd697dc-88d4p:80/100.66.130.94:80.
git-commit: 082a6d415be982b1f92c35e55dd71609d4576d3e
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.1-2025.09.37-1.0