Invitrogen

TGFBR2 Monoclonal Antibody (2F11)

Advanced Verification
View all (31) TGFBR2 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers
TGFBR2 Monoclonal Antibody (2F11)

Product Details

MA5-49166

Applications
Tested Dilution
Publications

Western Blot (WB)

0.25-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL
-

Immunocytochemistry (ICC/IF)

5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Mouse / IgG2b

Class

Monoclonal

Type

Antibody

Clone

2F11

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_3074824

Product Specific Information

Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Immunogen sequence different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.

Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human K562 whole cell, human Caco-2 whole cell, human Hela whole cell, human T-47D whole cell. IHC: human placenta tissue, human cervical intraepithelial neoplasia tissue, human esophageal squamous carcinoma tissue. ICC/IF: HepG2 cell. Flow: A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

Transforming Growth Factor, beta receptor 2 (AAT3, FAA3, MFS2, RIIC, LDS1B, LDS2B, TAAD2, TGFR-2, TGFbeta-RII) is a member of the TGF-beta family of receptor Serine/Threonine kinases. It is involved in the regulation of cell proliferation. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). TGFBR2 encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. TGFBR2 also has a pseudogene on chromosome 14.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: tbetaR-II; tgf beta receptor 2; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGF-beta type II receptor; TGFbeta RII; TGFR-2; TGFR2; transforming growth factor beta receptor II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; Transforming growth factor-beta receptor type II

View more View less

Gene Aliases: AAT3; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; TAAD2; TGFbeta-RII; TGFBR2; TGFR-2

View more View less

UniProt ID: (Human) P37173

View more View less

Entrez Gene ID: (Human) 7048

View more View less

Function(s)
transmembrane receptor protein serine/threonine kinase activity receptor signaling protein serine/threonine kinase activity transforming growth factor beta-activated receptor activity transforming growth factor beta receptor activity, type II protein binding ATP binding glycosaminoglycan binding mitogen-activated protein kinase kinase kinase binding type I transforming growth factor beta receptor binding SMAD binding metal ion binding transforming growth factor beta binding
Process(es)
blood vessel development patterning of blood vessels vasculogenesis in utero embryonic development heart looping positive regulation of mesenchymal cell proliferation lens development in camera-type eye positive regulation of tolerance induction to self antigen positive regulation of B cell tolerance induction positive regulation of T cell tolerance induction outflow tract morphogenesis growth plate cartilage chondrocyte growth protein phosphorylation receptor-mediated endocytosis apoptotic process transforming growth factor beta receptor signaling pathway common-partner SMAD protein phosphorylation Notch signaling pathway smoothened signaling pathway gastrulation brain development heart development embryo implantation aging response to nutrient positive regulation of cell proliferation response to mechanical stimulus response to glucose regulation of gene expression positive regulation of epithelial cell migration positive regulation of epithelial to mesenchymal transition peptidyl-serine phosphorylation peptidyl-threonine phosphorylation signal transduction by protein phosphorylation negative regulation of transforming growth factor beta receptor signaling pathway organ regeneration activation of protein kinase activity embryonic hemopoiesis wound healing regulation of cell proliferation response to drug myeloid dendritic cell differentiation positive regulation of skeletal muscle tissue regeneration response to estrogen positive regulation of angiogenesis response to steroid hormone digestive tract development positive regulation of smooth muscle cell proliferation embryonic cranial skeleton morphogenesis positive regulation of NK T cell differentiation palate development negative regulation of cardiac muscle cell proliferation pathway-restricted SMAD protein phosphorylation ventricular septum morphogenesis bronchus morphogenesis trachea formation mammary gland morphogenesis lung lobe morphogenesis response to cholesterol positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation lens fiber cell apoptotic process positive regulation of reactive oxygen species metabolic process
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support