Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • RhoB Antibodies

Invitrogen

RhoB Polyclonal Antibody

View all (16) RhoB antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite RhoB Polyclonal Antibody

  • Antibody Testing Data (4)
RhoB Antibody in Immunocytochemistry (ICC/IF)
Group 53 Created with Sketch.
RhoB Antibody in Immunocytochemistry (ICC/IF)
Group 53 Created with Sketch.

FIGURE: 1 / 4

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

RhoB Antibody (PA5-95631) in ICC/IF

Immunocytochemistry analysis of RHOB using anti-RHOB antibody (Product # PA5-95631) . RHOB was detected in an immunocytochemical section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-RHOB antibody (Product # PA5-95631) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was countersta... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

RhoB Antibody in Immunocytochemistry (ICC/IF)
RhoB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
RhoB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
RhoB Antibody in Western Blot (WB)
RhoB Polyclonal Antibody

Product Details

PA5-95631

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

5 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse, Non-human primate, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human RHOB (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Wet ice

RRID

AB_2807433

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Hela whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, monkey COS-7 whole cell. IHC: human renal cancer tissue, human mammary cancer tissue. ICC/IF: U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

Rho-related GTP-binding protein (RhoB) mediates apoptosis in neoplastically transformed cells after DNA damage. While not essential for development, it does affect cell adhesion and growth factor signaling in transformed cells. RhoB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a tumor supressor - deletion of RhoB causes tumor formation.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Aplysia RAS-related homolog 6; aplysia ras-related homolog B; h6; oncogene RHO H6; ras homolog B; ras homolog gene family, member AB; ras homolog gene family, member B; Rho; Rho cDNA clone 6; Rho-related GTP-binding protein RhoB; rhoB

View more View less

Gene Aliases: AA017882; ARH6; ARHB; MST081; MSTP081; RHOB; RHOH6

View more View less

UniProt ID: (Human) P62745, (Rat) P62747, (Mouse) P62746

View more View less

Entrez Gene ID: (Human) 388, (Rat) 64373, (Mouse) 11852

View more View less

Function(s)
GTPase activity protein binding GTP binding GDP binding nucleotide binding
Process(es)
angiogenesis intracellular protein transport obsolete transformed cell apoptotic process cell adhesion small GTPase mediated signal transduction endosome to lysosome transport cell differentiation positive regulation of apoptotic process positive regulation of angiogenesis negative regulation of cell cycle cellular response to hydrogen peroxide cellular response to ionizing radiation cytokinesis transport apoptotic process multicellular organism development protein transport Rho protein signal transduction positive regulation of endothelial cell migration platelet activation regulation of cell migration negative regulation of cell migration regulation of small GTPase mediated signal transduction endothelial tube morphogenesis
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0