Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • LRTOMT Antibodies

Invitrogen

LRTOMT Polyclonal Antibody

View all (2) LRTOMT antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite LRTOMT Polyclonal Antibody

  • Antibody Testing Data (7)
LRTOMT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.
LRTOMT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.

FIGURE: 1 / 7

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

LRTOMT Antibody (PA5-114402) in IHC (P)

Immunohistochemistry analysis of LRTOMT in paraffin-embedded human Lung cancer tissues. Antigen retrieval was performed with citrate buffer (pH6, 20 min). Samples were blocked with 10% goat serum and incubated in LRTOMT polyclonal antibody (Product # PA5-114402) at a dilution of 1 µg/mL (overnight, 4°C), followed by biotinylated goat anti-rabbit IgG (30 min, 37°C) and Strepavidin-Biotin-Complex (SABC) with ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

LRTOMT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
LRTOMT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
LRTOMT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
LRTOMT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
LRTOMT Antibody in Immunohistochemistry (Paraffin) (IHC (P))
LRTOMT Antibody in Western Blot (WB)
LRTOMT Antibody in Western Blot (WB)
LRTOMT Polyclonal Antibody

Product Details

PA5-114402

Applications
Tested Dilution
Publications

Western Blot (WB)

0.5-1 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

1-2 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Wet ice

RRID

AB_2884858

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human placenta tissue, human MCF-7 whole cell, human Hela whole cell, human Caco-2 whole cell, human K562 whole cell, human U20S whole cell, human THP-1 whole cell, rat brain tissue, rat ovarian tissue, rat heart tissue, rat lung tissue, mouse brain tissue, mouse lung tissue. IHC: human placenta tissue, human Lung cancer tissue, mouse brain tissue, mouse brain tissue, rat brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Required for auditory function.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Catechol O-methyltransferase 2; catechol O-methyltransferase 2 {ECO:0000250|UniProtKB:A1Y9I9}; leucine rich transmembrane and 0-methyltransferase domain containing; Leucine-rich repeat-containing protein 51; leucine-rich repeat-containing protein 51 {ECO:0000312|RGD:1565856}; lrrc51 {ECO:0000312|RGD:1565856}; O-methyltransferase domain containing; protein LRTOMT1; Protein LRTOMT2; tomt {ECO:0000312|RGD:1561509}; Transmembrane O-methyltransferase; Transmembrane O-methyltransferase homolog; transmembrane O-methyltransferase {ECO:0000312|RGD:1561509}

View more View less

Gene Aliases: 1700008D07Rik; CFAP111; COMT2; DFNB63; LRRC51; LRTOMT; PP7517; RGD1561509; RGD1565856; TOMT

View more View less

UniProt ID: (Human) Q8WZ04, (Mouse) Q9DAK8, (Rat) B6CZ61, (Rat) B6CZ62

View more View less

Entrez Gene ID: (Human) 220074, (Mouse) 69358, (Rat) 293156, (Rat) 308868

View more View less

Function(s)
catechol O-methyltransferase activity molecular_function
Process(es)
biological_process sensory perception of sound methylation neurotransmitter catabolic process catecholamine catabolic process auditory receptor cell development
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0