Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • ITLN1 Antibodies

Invitrogen

ITLN1 Polyclonal Antibody

View all (20) ITLN1 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite ITLN1 Polyclonal Antibody

  • Antibody Testing Data (4)
ITLN1 Antibody in Immunocytochemistry (ICC/IF)
Group 53 Created with Sketch.
ITLN1 Antibody in Immunocytochemistry (ICC/IF)
Group 53 Created with Sketch.

FIGURE: 1 / 4

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

ITLN1 Antibody (PA5-79543) in ICC/IF

Immunocytochemistry analysis of ITLN1 using anti-ITLN1 antibody (Product # PA5-79543) . ITLN1 was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-ITLN1 antibody (Product # PA5-79543) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. V... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

ITLN1 Antibody in Immunocytochemistry (ICC/IF)
ITLN1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
ITLN1 Antibody in Western Blot (WB)
ITLN1 Antibody in Flow Cytometry (Flow)
ITLN1 Polyclonal Antibody

Product Details

PA5-79543

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

2 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746658

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: SW620 whole cell. IHC: human intestinal cancer tissue. ICC/IF: U20S cell. Flow: U937 cell.

Target Information

ITLN1 has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. ITLN1 increases AKT phosphorylation in the absence and presence of insulin. ITLN1 may play a role in the defense system against microorganisms. ITLN1 may specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. ITLN1 may be involved in iron metabolism.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Endothelial lectin HL-1; FLJ20022; Galactofuranose-binding lectin; intelectin 1 (galactofuranose binding); Intelectin-1; Intestinal lactoferrin receptor; ITLN-1; Omentin

View more View less

Gene Aliases: hIntL; HL-1; HL1; INTL; ITLN; ITLN1; LFR; omentin; UNQ640/PRO1270

View more View less

UniProt ID: (Human) Q8WWA0

View more View less

Entrez Gene ID: (Human) 55600

View more View less

Function(s)
carbohydrate binding
Process(es)
positive regulation of protein phosphorylation response to nematode positive regulation of glucose import
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0