Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • Cytochrome P450 Reductase Antibodies

Invitrogen

Cytochrome P450 Reductase Monoclonal Antibody (7F5)

View all (37) Cytochrome P450 Reductase antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite Cytochrome P450 Reductase Monoclonal Antibody (7F5)

  • Antibody Testing Data (7)
Cytochrome P450 Reductase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.
Cytochrome P450 Reductase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.

FIGURE: 1 / 7

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

Cytochrome P450 Reductase Antibody (MA5-49218) in IHC (P)

Immunohistochemistry analysis of Cytochrome P450 Reductase in paraffin-embedded section of human esophageal squamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. Samples were incubated with Cytochrome P450 Reductase Monoclonal antibody (Product # MA5-49218) using a dilution of 2 μg/mL ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

Cytochrome P450 Reductase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Cytochrome P450 Reductase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Cytochrome P450 Reductase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Cytochrome P450 Reductase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Cytochrome P450 Reductase Antibody in Western Blot (WB)
Cytochrome P450 Reductase Antibody in Flow Cytometry (Flow)
Cytochrome P450 Reductase Antibody in Flow Cytometry (Flow)
Cytochrome P450 Reductase Monoclonal Antibody (7F5)

Product Details

MA5-49218

Applications
Tested Dilution
Publications

Western Blot (WB)

0.25-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Mouse / IgG2b

Class

Monoclonal

Type

Antibody

Clone

7F5

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_3074876

Product Specific Information

Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Immunogen sequence is different from the related mouse and rat sequences by five amino acids.

Positive Control - WB: human HepG2 whole cell, human A549 whole cell. IHC: human esophageal squamous carcinoma tissue, human liver cancer tissue, human lung cancer tissue, human placenta tissue. Flow: SiHa cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: CCR; CPR; CY DKFZp686G04235; DKFZp686G04235; FLJ26468; NADPH Cytochrome; NADPH--cytochrome P450 reductase; NADPH-dependent cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; P450 Reductase

View more View less

Gene Aliases: CPR; CYPOR; P450R; POR

View more View less

UniProt ID: (Human) P16435

View more View less

Entrez Gene ID: (Human) 5447

View more View less

Function(s)
NADPH-hemoprotein reductase activity cytochrome-b5 reductase activity, acting on NAD(P)H protein binding nitric oxide dioxygenase activity electron carrier activity FMN binding hydrolase activity enzyme binding [methionine synthase] reductase activity iron-cytochrome-c reductase activity flavin adenine dinucleotide binding NADP binding
Process(es)
regulation of growth plate cartilage chondrocyte proliferation xenobiotic metabolic process response to nutrient carnitine metabolic process flavonoid metabolic process internal peptidyl-lysine acetylation fatty acid oxidation positive regulation of chondrocyte differentiation positive regulation of monooxygenase activity response to drug negative regulation of cysteine-type endopeptidase activity involved in apoptotic process nitrate catabolic process positive regulation of cholesterol biosynthetic process positive regulation of smoothened signaling pathway nitric oxide catabolic process oxidation-reduction process negative regulation of lipase activity demethylation cellular response to follicle-stimulating hormone stimulus cellular response to peptide hormone stimulus positive regulation of steroid hormone biosynthetic process cellular organofluorine metabolic process
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0