Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • CLN2 Antibodies

Invitrogen

CLN2 Polyclonal Antibody

View all (18) CLN2 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite CLN2 Polyclonal Antibody

  • Antibody Testing Data (2)
CLN2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.
CLN2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.

FIGURE: 1 / 2

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

CLN2 Antibody (PA5-95344) in IHC (P)

Immunohistochemistry analysis of CLN2 in paraffin-embedded human lung cancer tissues. Samples were incubated with CLN2 polyclonal antibody (Product # PA5-95344) at a 1 µg/mL dilution, and developed with Strepavidin-Biotin-Complex. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

CLN2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
CLN2 Antibody in Western Blot (WB)
CLN2 Polyclonal Antibody

Product Details

PA5-95344

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2807147

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: HELA whole cell. IHC: human lung cancer tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Cell growth-inhibiting gene 1 protein; CLN 2; GIG 1; growth-inhibiting protein 1; LPIC; lysosomal pepstatin insensitive protease; Lysosomal pepstatin-insensitive protease; MGC21297; TPP 1; TPP I; TPP-1; TPP-I; TPPI; Tripeptidyl aminopeptidase; tripeptidyl peptidase I; Tripeptidyl-peptidase 1; Tripeptidyl-peptidase I

View more View less

Gene Aliases: CLN2; GIG1; LPIC; SCAR7; TPP-1; TPP1; UNQ267/PRO304

View more View less

UniProt ID: (Human) O14773

View more View less

Entrez Gene ID: (Human) 1200

View more View less

Function(s)
endopeptidase activity serine-type endopeptidase activity protein binding peptidase activity serine-type peptidase activity tripeptidyl-peptidase activity peptide binding metal ion binding
Process(es)
proteolysis lipid metabolic process lysosome organization nervous system development central nervous system development protein catabolic process epithelial cell differentiation IRE1-mediated unfolded protein response peptide catabolic process bone resorption neuromuscular process controlling balance
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0