Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • BAX Antibodies

Invitrogen

Bax Polyclonal Antibody

View all (96) BAX antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite Bax Polyclonal Antibody

  • Antibody Testing Data (1)
Bax Antibody in Western Blot (WB)
Group 53 Created with Sketch.
Bax Antibody in Western Blot (WB)
Group 53 Created with Sketch.

FIGURE: 1 / 1

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

Bax Antibody (PA5-78857) in WB

Western blot was performed using Anti-Bax Polyclonal Antibody(Product # PA5-78857) and a 19 kDa band corresponding to Bax was observed across cell lines and tissues tested. Whole Cell Extract-WCL (30 µg µg lysate) of MCF7 (Lane 1),,MCF7 treated with etoposide (50 µM, 16Hrs)(Lane 2), A549 (Lane 3),A549 treated with etoposide (50 µM, 16Hrs) (Lane 4) were electrophoresed using NuPAGE™ 4-12% Bis-Tris Protein Gel (Product # NP0322BOX). Resolved proteins were then transferred onto a Nitrocellulose membrane (Product # LC2002) by iBlot® 2 Dry Blot... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

Bax Antibody in Western Blot (WB)
Bax Polyclonal Antibody

Product Details

PA5-78857

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (IHC)

-
- -

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2745973

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: rat thymus tissue, mouse thymus tissue, HEPA1-6 whole cell, HELA whole cell, MCF-7 whole cell. IHC: human lung cancer tissue, rat intestine tissue, human intetsinal cancer tissue, mouse intestine tissue. Flow: A549 cell.

Target Information

BAX is a members of the Bcl-2 Family and plays an important role in regulation of apoptosis. Whereas Bcl-2 is commonly regarded as an anti-apoptotic protein, BAX is considered to have a pro-apoptotic function. Regulation of apoptosis is supposed to involve both homo- and heterodimerization of different isoforms of BAX and Bcl-2. The Bax gene encodes different isoforms including Bax alpha (21 kDa) and Bax beta (24 kDa), whereas both isoforms contain the BH1, BH2 and BH3 domains, Bax beta has a unique carboxyl terminus and does not contain a hydrophobic transmembrane domain. Bcl-2 is also expressed in different Isoforms. Bcl-2 beta differs in the 3' UTR and coding region compared to variant alpha. Bcl-2 beta is shorter (22 kDa) and has a distinct C-terminus compared to Bcl-2 alpha (26 kDa). BAX is a member of the BCL-2 family of proteins, which function as regulators of apoptosis. Overexpression of BAX functions to promote cell death. BAX can form homodimers and is also able to heterodimerize with other BCL-2 related proteins.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Apoptosis regulator BAX; Bax zeta; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2-associated X protein omega; Bcl2-L-4

View more View less

Gene Aliases: BAX; BCL2L4

View more View less

UniProt ID: (Human) Q07812, (Mouse) Q07813

View more View less

Entrez Gene ID: (Human) 581, (Rat) 24887, (Mouse) 12028

View more View less

Function(s)
protein binding lipid binding channel activity heat shock protein binding protein complex binding identical protein binding protein homodimerization activity protein heterodimerization activity chaperone binding BH3 domain binding BH domain binding
Process(es)
ovarian follicle development neuron migration T cell homeostatic proliferation B cell homeostasis B cell apoptotic process kidney development release of cytochrome c from mitochondria protein insertion into mitochondrial membrane involved in apoptotic signaling pathway blood vessel remodeling myeloid cell homeostasis B cell negative selection B cell homeostatic proliferation positive regulation of B cell apoptotic process glycosphingolipid metabolic process regulation of nitrogen utilization apoptotic process activation of cysteine-type endopeptidase activity involved in apoptotic process DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest activation of signaling protein activity involved in unfolded protein response inner mitochondrial membrane organization outer mitochondrial membrane organization germ cell development aging mitochondrial fusion extrinsic apoptotic signaling pathway via death domain receptors intrinsic apoptotic signaling pathway in response to DNA damage activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c apoptotic mitochondrial changes fertilization response to toxic substance response to salt stress establishment or maintenance of transmembrane electrochemical gradient response to gamma radiation viral process hypothalamus development cerebral cortex development negative regulation of protein binding positive regulation of protein oligomerization endoplasmic reticulum calcium ion homeostasis negative regulation of endoplasmic reticulum calcium ion concentration release of matrix enzymes from mitochondria negative regulation of peptidyl-serine phosphorylation regulation of mammary gland epithelial cell proliferation glial cell apoptotic process cellular response to UV ectopic germ cell programmed cell death response to cocaine odontogenesis of dentin-containing tooth response to drug regulation of apoptotic process positive regulation of apoptotic process regulation of protein homodimerization activity regulation of protein heterodimerization activity negative regulation of neuron apoptotic process positive regulation of neuron apoptotic process mitochondrial fragmentation involved in apoptotic process development of secondary sexual characteristics cellular respiration retinal cell programmed cell death response to copper ion positive regulation of developmental pigmentation negative regulation of fibroblast proliferation spermatid differentiation post-embryonic camera-type eye morphogenesis response to axon injury homeostasis of number of cells within a tissue protein oligomerization protein homooligomerization positive regulation of release of sequestered calcium ion into cytosol neuron apoptotic process response to corticosterone regulation of mitochondrial membrane potential Sertoli cell proliferation retina development in camera-type eye positive regulation of apoptotic process involved in mammary gland involution vagina development intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress thymocyte apoptotic process mitochondrion morphogenesis intrinsic apoptotic signaling pathway by p53 class mediator positive regulation of release of cytochrome c from mitochondria apoptotic signaling pathway extrinsic apoptotic signaling pathway extrinsic apoptotic signaling pathway in absence of ligand intrinsic apoptotic signaling pathway activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway positive regulation of endoplasmic reticulum unfolded protein response positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway apoptotic process involved in patterning of blood vessels apoptotic process involved in embryonic digit morphogenesis regulation of mitochondrial membrane permeability involved in programmed necrotic cell death positive regulation of apoptotic DNA fragmentation positive regulation of IRE1-mediated unfolded protein response B cell receptor apoptotic signaling pathway negative regulation of apoptotic signaling pathway positive regulation of extrinsic apoptotic signaling pathway in absence of ligand positive regulation of intrinsic apoptotic signaling pathway leukocyte homeostasis obsolete transformed cell apoptotic process cellular response to DNA damage stimulus spermatogenesis nervous system development brain development sex differentiation cell proliferation negative regulation of cell proliferation male gonad development response to wounding post-embryonic development response to ionizing radiation positive regulation of calcium ion transport into cytosol limb morphogenesis regulation of cysteine-type endopeptidase activity involved in apoptotic process regulation of neuron apoptotic process homeostasis of number of cells regulation of cell cycle cellular response to organic substance regulation of mitochondrial membrane permeability involved in apoptotic process positive regulation of mitochondrial membrane permeability involved in apoptotic process retinal cell apoptotic process transmembrane transport
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0