Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • ACADVL Antibodies

Invitrogen

ACADVL Polyclonal Antibody

View all (12) ACADVL antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite ACADVL Polyclonal Antibody

  • Antibody Testing Data (7)
ACADVL Antibody in Immunocytochemistry (ICC/IF)
Group 53 Created with Sketch.
ACADVL Antibody in Immunocytochemistry (ICC/IF)
Group 53 Created with Sketch.

FIGURE: 1 / 7

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

ACADVL Antibody (PA5-78710) in ICC/IF

Immunocytochemistry/Immunofluorescence analysis of ACADVL in U2OS cells using ACADVL Polyclonal Antibody (Product # PA5-78710). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. DyLight 488 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter s... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

ACADVL Antibody in Immunocytochemistry (ICC/IF)
ACADVL Antibody in Immunohistochemistry (Paraffin) (IHC (P))
ACADVL Antibody in Immunohistochemistry (Paraffin) (IHC (P))
ACADVL Antibody in Immunohistochemistry (Paraffin) (IHC (P))
ACADVL Antibody in Western Blot (WB)
ACADVL Antibody in Western Blot (WB)
ACADVL Antibody in Flow Cytometry (Flow)
ACADVL Polyclonal Antibody

Product Details

PA5-78710

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (IHC)

2-5 µg/mL
-

Immunocytochemistry (ICC/IF)

5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-

Immunoprecipitation (IP)

0.5-2 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2745826

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Hela whole cell lysates, human SiHa whole cell lysates, human A431 whole cell lysates, human U251 whole cell lysates, rat liver tissue lysates, rat heart tissue lysates, mouse liver tissue lysates, mouse heart tissue lysates. IHC: human liver cancer tissue, human ovarian cancer tissue, rat heart tissue. Flow: U251 cell.

Target Information

The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: acyl-Coenzyme A dehydrogenase, very long chain; MVLCAD; Very long chain Acyl-Coa dehydrogenase; Very long-chain specific acyl-CoA dehydrogenase, mitochondrial; VLCAD; VLCAD very-long-chain acyl-CoA dehydrogenase

View more View less

Gene Aliases: ACAD6; ACADVL; LCACD; VLCAD

View more View less

UniProt ID: (Human) P49748, (Rat) P45953, (Mouse) P50544

View more View less

Entrez Gene ID: (Human) 37, (Rat) 25363, (Mouse) 11370

View more View less

Function(s)
fatty-acyl-CoA binding acyl-CoA dehydrogenase activity long-chain-acyl-CoA dehydrogenase activity electron carrier activity very-long-chain-acyl-CoA dehydrogenase activity flavin adenine dinucleotide binding oxidoreductase activity, acting on the CH-CH group of donors, with a flavin as acceptor oxidoreductase activity oxidoreductase activity, acting on the CH-CH group of donors
Process(es)
temperature homeostasis fatty acid beta-oxidation energy derivation by oxidation of organic compounds epithelial cell differentiation fatty acid beta-oxidation using acyl-CoA dehydrogenase IRE1-mediated unfolded protein response very long-chain fatty acid catabolic process negative regulation of fatty acid biosynthetic process negative regulation of fatty acid oxidation lipid homeostasis regulation of cholesterol metabolic process lipid metabolic process fatty acid metabolic process metabolic process oxidation-reduction process
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0