Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD86 Proteins

Invitrogen

Human CD86 (aa 283-313) Control Fragment Recombinant Protein

View all (2) CD86 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD86 (aa 283-313) Control Fragment Recombinant Protein

Product Details

RP-108762

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

GTNTMEREESEQTKKREKIHIPERSDEAQRV

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD86, along with CD80, is a member of the B7 family of costimulatory molecules and plays a crucial role in T cell activation and immune response regulation. CD86 is expressed at low levels on B cells, macrophages, and dendritic cells, and its expression is upregulated on B cells through various stimuli, including the BCR complex, CD40, and certain cytokine receptors. As a type I membrane protein and member of the immunoglobulin superfamily, CD86 serves as a ligand for the T cell surface proteins CD28 and CTLA-4 (CD152). The interaction between CD86 and CD28 provides a costimulatory signal essential for T cell activation during antigen presentation, while binding with CTLA-4 negatively regulates T cell activation, diminishing the immune response. This interaction is critical for T-B cell crosstalk, T cell costimulation, autoantibody production, and Th2-mediated Ig production. The kinetics of CD86 upregulation upon stimulation suggest its significant contribution during the primary phase of an immune response. CD86 and CD80 have distinct roles in T helper cell differentiation, and insufficient co-stimulation involving these molecules can induce tolerance. Alternative splicing of CD86 results in two transcript variants encoding different isoforms, with additional variants described but not fully sequenced. Dysfunction in CD86 is associated with diseases such as gallbladder squamous cell carcinoma and myocarditis.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Activation B7-2 antigen; B lymphocyte activation antigen B72; B-lymphocyte activation antigen B7-2; B70; BU63; CD28 antigen ligand 2; CD86; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); CTLA-4 counter-receptor B7.2; Early T-cell co-stimulatory molecule 1; FUN-1; MGC34413; T-lymphocyte activation antigen CD86

View more View less

Gene Aliases: B7-2; B7.2; B70; CD28LG2; CD86; LAB72

View more View less

UniProt ID: (Human) P42081

View more View less

Entrez Gene ID: (Human) 942

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-5f5c96ff6c-st5hm:80/100.66.129.203:80.
git-commit: 945c3ce0b94337c0c8e9574aed9898c23d0d1109
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.1-2025.09.37-1.0