Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD38 Proteins

Invitrogen

Human CD38 (aa 54-180) Control Fragment Recombinant Protein

View all (4) CD38 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD38 (aa 54-180) Control Fragment Recombinant Protein

Product Details

RP-103122

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

GTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84111. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD38 is a multifunctional ectoenzyme and type II transmembrane glycoprotein involved in various cellular processes. It catalyzes the conversion of NAD into secondary messengers such as nicotinic acid adenine dinucleotide phosphate (NAADP) and cyclic ADP-ribose (cADPR). CD38 plays a crucial role in B cell development, with expression levels fluctuating from high in immature cells to low in intermediate ones, and back to high in mature B cells. It is also present in a variety of tissues and hematopoietic cells, including T cells, NK cells, and monocytes, and is used to phenotype leukemias and monitor HIV-1 progression. The CD34+CD38- population is considered to define the most pluripotent hematopoietic stem cells. In addition to its surface expression, CD38 has been identified in the nucleus, where it may regulate calcium levels. It functions as a multi-catalytic ectoenzyme, serving roles as an ADP-ribosyl cyclase, cyclic ADP-ribose hydrolase, and possibly NAD+ glycohydrolase, or as a cell surface receptor. CD38 is involved in the activation, proliferation, and differentiation of mature lymphocytes and mediates apoptosis of myeloid and lymphoid progenitor cells. It also participates in cell adhesion, signal transduction, and calcium signaling. Antibodies to CD38 are valuable for subtyping lymphomas and leukemias, detecting plasma cells (such as in myelomas), and marking activated B and T cells. CD38 is expressed at high levels in the pancreas, liver, kidney, malignant lymphoma, and neuroblastoma. Dysfunctions in CD38 are associated with diseases like chronic lymphocytic leukemia and Richter's Syndrome.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: 2'-phospho-ADP-ribosyl cyclase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-cyclic-ADP-ribose transferase; ADP-ribosyl cyclase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; ADPRC 1; cADPR hydrolase 1; CD38; CD38 antigen (p45); CD38 antigen p45; cluster of differentiation 38; Cyclic ADP-ribose hydrolase 1; ecto-nicotinamide adenine dinucleotide glycohydrolase; NAD(+) nucleosidase; NAD+ nucleosidase; T10

View more View less

Gene Aliases: ADPRC 1; ADPRC1; CD38

View more View less

UniProt ID: (Human) P28907

View more View less

Entrez Gene ID: (Human) 952

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-585975bbdc-x5cgg:80/100.66.128.25:80.
git-commit: a17be567db00e29ba041ba55be3678c43488a11a
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0