Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • CD22 Proteins

Invitrogen

Human CD22 (aa 450-538) Control Fragment Recombinant Protein

View all (15) CD22 proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD22 (aa 450-538) Control Fragment Recombinant Protein

Product Details

RP-109832

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%).

This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD22, also known as BL-CAM, is a type I transmembrane glycoprotein composed of two polypeptide chains, CD22alpha and CD22beta, with molecular weights of 130 and 140 kDa, respectively. These chains are produced by alternative splicing of the CD22 gene. CD22 is prominently expressed on mature B cells and B cell lymphomas, including hairy cell leukemia, diffuse large B-cell lymphoma, and nodular lymphocyte predominance Hodgkin's lymphoma, but is negative in classical Hodgkin's lymphoma. The extracellular portion of CD22 contains seven Ig-like domains that preferentially bind alpha2,6-linked sialic acid moieties found on epithelial, endothelial, B, and T cells. This binding can be masked by cis interactions with sialic acids on the same cell surface. CD22 expression is limited to late stages of B-cell differentiation, making it useful for phenotyping mature leukemias. Intracellularly, CD22 features six tyrosine residues within immunotyrosine-based inhibitory motifs (ITIM) and activation-like motifs. These residues are phosphorylated upon B-cell receptor engagement, allowing CD22 to regulate B-cell receptor signaling. CD22 participates in positive regulation through interactions with Src family tyrosine kinases and acts as an inhibitory receptor by recruiting cytoplasmic phosphatases via SH2 domains, which block signal transduction through dephosphorylation of signaling molecules. CD22's role in both positive and negative regulation of B-cell signaling, along with its specific expression pattern, makes it a valuable marker for antibody customers interested in B-cell-related research and diagnostics.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: B-cell receptor CD22; B-lymphocyte cell adhesion molecule; B-lymphocyte cell adhesion molecule (BL-CAM); BL-CAM; CD22; CD22 antigen; FLJ22814; Lectin 2; Leu-14; MGC130020; sialic acid binding Ig-like lectin 2; Sialic acid-binding Ig-like lectin 2; Sialic acid-binding Ig-like lectin 2 (Siglec-2); Siglec-2; T-cell surface antigen Leu-14

View more View less

Gene Aliases: CD22; SIGLEC-2; SIGLEC2

View more View less

UniProt ID: (Human) P20273

View more View less

Entrez Gene ID: (Human) 933

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-585975bbdc-x5cgg:80/100.66.128.25:80.
git-commit: a17be567db00e29ba041ba55be3678c43488a11a
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0