Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Proteins & Peptides ›
  • Fas Ligand (CD178) Proteins

Invitrogen

Human CD178 (aa 122-191) Control Fragment Recombinant Protein

View all (2) Fas Ligand (CD178) proteins

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Tech Support
Datasheet
Tech Support

Cite Human CD178 (aa 122-191) Control Fragment Recombinant Protein

Product Details

RP-103987

Applications
Tested Dilution
Publications

Control (Ctrl)

Assay-dependent
-

Blocking Assay (BLOCK)

Assay-dependent
-
Product Specifications

Species

Human

Expression System

E. coli

Amino acid sequence

HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV

Tag

His-ABP-tag

Class

Recombinant

Type

Protein

Purity

>80% by SDS-PAGE and Coomassie blue staining

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

≥5.0 mg/mL

Purification

purified

Storage buffer

PBS/1M urea, pH 7.4

Contains

no preservative

Storage conditions

-20°C, Avoid Freeze/Thaw Cycles

Shipping conditions

Wet ice

Product Specific Information

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%).

This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84227. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Target Information

CD178 (Fas ligand, FasL) is a type-II-membrane protein, whose N-terminus is in the cytoplasm and its C-terminal region extends into the extracellular space. Its receptor, FasR, is a cell-surface-type-I-membrane protein and a member of the tumor necrosis factor (TNF) and nerve growth factor (NGF) receptor family. As a member of the TNF-cytokine family CD178 induces apoptosis when interacting with FasR. CD178 may exist as either membrane bound (45 kD) or soluble forms (26 kD). The soluble protein can be released from cells upon cleavage by metalloproteinases. Binding of CD178 to Fas leads to oligomerization of the receptor and triggers apoptotic cell death through the interaction of other proteins. CD178 is predominantly expressed in activated T-lymphocytes and natural killer (NK) cells also it is expressed in the tissues of immune-privilege sites such as testis and eye. CD178 expression is also reported in various tissues as thymus, liver, ovary, lung, heart and kidney. It is assumed that induction of apoptosis through CD178 is predominantly involved in anti-viral immune responses. CD178 is a cell surface molecule belonging to the tumor necrosis factor family, binds to its receptor Fas, thus inducing apoptosis. Various cells express FAS, where CD178 is expressed predominantly on activated T cells. FAS and CD178 are involved in the down-regulation of immune reactions as well as T cell-mediated cytotoxicity. CD178 concentration has also been shown to be associated with atherosclerosis and inflammatory disease, in patients with hypertension. The Fas/ CD178 system has been shown to play a role in a number of human diseases, for example AIDS, hepatitis or cancer.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Apoptosis (APO 1) antigen ligand 1; apoptosis (APO-1) antigen ligand 1; Apoptosis antigen ligand; APTL; CD178; CD178 antigen; CD95 ligand; CD95 ligand protein;Generalized lymphoproliferative disease (Gld); CD95-L; Fas antigen ligand; Fas ligand; Fas ligand (TNF superfamily, member 6); Fas-LG; mutant tumor necrosis factor family member 6; soluble form; TNFL; Tumor necrosis factor (ligand) superfamily member 6; Tumor necrosis factor ligand; tumor necrosis factor ligand 1A; Tumor necrosis factor ligand superfamily member 6; Tumor necrosis factor ligand superfamily member 6 (TNFL6 / TNFSF6)

View more View less

Gene Aliases: ALPS1B; APT1LG1; APTL; CD178; CD95-L; CD95L; FASL; FASLG; TNFSF6; TNLG1A

View more View less

UniProt ID: (Human) P48023

View more View less

Entrez Gene ID: (Human) 356

View more View less

It has to be done as per old AB suggested Products section.
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-585975bbdc-mkbg2:80/100.66.129.29:80.
git-commit: a17be567db00e29ba041ba55be3678c43488a11a
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.37.0-2025.10.41-1.0