• ELISA Kits ›
  • AP36 ELISA Kits

Invitrogen

Human AP36 Competitive ELISA Kit

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Technical guide & protocol Tech Support
Technical guide & protocol Tech Support
Technical guide & protocol Tech Support
Human AP36 Competitive ELISA Kit
Group 53 Created with Sketch.
Human AP36 Competitive ELISA Kit
Group 53 Created with Sketch.

FIGURE: 1 / 3

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

Human AP36 Competitive ELISA Kit

ELISA Standard Curve of AP36 using Human AP36 Competitive ELISA Kit (Product # EEL169). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

Human AP36 Competitive ELISA Kit
Human AP36 Competitive ELISA Kit (EEL169)
videoThumbnail
►

Product Specifications

Analytical sensitivity

28.13 pg/mL

Assay range

46.88-3,000 pg/mL

Sample type/volume

Tissue Homogenate
50 µL
Cell Lysate
50 µL
Plasma
50 µL
Serum
50 µL

Hands-on time

1 hr 20 min

Time-to-result

2 hr 30 min

Homogenous (no wash)

No

Interassay CV

<10%

Intraassay CV

<10%

Instrument

Absorbance Microplate Reader

Product size

96 Tests

Contents

Pre-coated 96 well plate, Standard, Biotinylated Detection Antibody, HRP Conjugate, Standard & Sample Diluent, Biotinylated Detection Antibody Diluent, HRP Conjugate Diluent, Wash Buffer, TMB Substrate, Stop Solution, Plate Sealer

Shipping conditions

Wet ice

Storage

Refer to product documentation for component specific storage temperature.

Protein name

AP36

Species (tested)

Human

Species (reported)

Human

Assay kit format

Competitive ELISA

Detector antibody conjugate

Biotin

Label or dye

HRP

About This Kit

The Human Apelin 36 (AP36) ELISA quantitates AP36 in serum, plasma and other biological fluids.

Principle of the method

The Competitive Alpha Melanocyte Stimulating Hormone (aMSH) ELISA research use only kit is designed to quantitatively measure aMSH in humans. An aMSH standard is provided to generate a standard curve for the assay and all samples are read off a user generated standard curve. Standards or diluted samples are pipetted into a coated microtiter plate and Biotinylated Detection Ab specific to Human aMSH is added. Excess conjugate and unbound sample or standard are washed from the plate, and Avidin conjugated to Horseradish Peroxidase (HRP) is added to each well and incubated. Then a TMB substrate solution is added to each well. The enzyme substrate reaction is terminated by the addition of stop solution and the color change is measured on a microplate reader. The concentration of Human aMSH in the samples is then determined by comparing the OD of the samples to the standard curve.

Rigorous validation:

Each manufactured lot of this ELISA kit is quality tested for criteria such as sensitivity, specificity, precision, and lot-to-lot consistency. See manual for more information on validation.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Target information

Apelin-36 is a peptide hormone that regulates cardiovascular function, fluid balance, and metabolism. It acts as a ligand for the apelin receptor and has vasodilatory effects, influences fluid balance, and potentially affects energy metabolism. It is produced by various tissues and consists of 36 amino acids (ARVYIHPNSYCFGGHLMDRFRNPTYLPLGCVRF-NH2)

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases : apelin-36, Apelin 36

Recommended Products

IL-6 Human Matched Antibody Pair

Because you are interested in IL-6 Human ELISA Kit.

SIZE

10 x 96 tests

PRICE

USD 400.00

Cat # CHC1263

guarantee_icon

Performance Guarantee

If an Invitrogen™ immunoassay doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-69fc894774-tvlwx:80/100.66.128.142:80.
git-commit: 8e82defa9bf25b3b77800b5e306013d4ba941391
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0