Invitrogen

SMAD1/SMAD5 Polyclonal Antibody

1 Published Figure
3 References
View all (5) SMAD1/SMAD5 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers
SMAD1/SMAD5 Polyclonal Antibody

Product Details

PA5-80036

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
View 3 publications 3 publications
Product Specifications

Species Reactivity

Human, Mouse, Rat

Published species

Human, Mammal, Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2747151

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: rat kidney tissue, rat testis tissue, mouse brain tissue, mouse kidney tissue, mouse testis tissue, human Hela cell, human A375 cell, human HepG2 cell.

Target Information

The Smad family of proteins are functioning in the transmission of extracellular signals in the TGF-beta signaling pathway. Binding of a TGF-beta superfamily ligands to extracellular receptors triggers phosphorylation of Smad2 at a Serine-Serine-Methionine-Serine (SSMS) motif at its C-terminus. Phosphorylated Smad2 is then able to form a complex with Smad4. These complexes accumulate in the cell nucleus, where they are directly participating in the regulation of gene expression. In mammals, eight Smad proteins have been identified to date. The Smad family of proteins can be divided into three functional groups: the receptor-activated Smads (R-Smads), common mediator Smads (Co-Smads), and the inhibitory Smads (I-Smads). The R-Smads are directly phosphorylated by the activated type I receptors on their C-terminal Ser-Ser-X-Ser (SSXS) motif and include Smad1, Smad2, Smad3, Smad5, and Smad8. Smad2 and Smad3 are phosphorylated in response to TGF-beta and activin, whereas Smad1, Smad5, and Smad8 are phosphorylated in response to BMP (Bone Morphogenetic Protein). This C-terminal phosphorylation allows R-Smad binding to Co-Smad, Smad4, and translocation to the nucleus where they regulate TGF-beta target genes. Smad6 and Smad7 belong to the I-Smad which bind to the type I receptor or Smad4 and block their interaction with R-Smads.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: BSP-1; Dwarfin-A; Dwarfin-C; Dwf-A; Dwf-C; hSMAD1; hSmad5; JV4-1; JV5-1; MAD (mothers against decapentaplegic, Drosophila) homolog 1; MAD homolog 1; MAD homolog 5; MAD homolog1 (mothers against decapentaplegic, Drosophila); MAD, mothers against decapentaplegic homolog 1; MAD, mothers against decapentaplegic homolog 5; Mad-related protein 1; mMad1; Mothers against decapentaplegic homolog 1; Mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; mothers against DPP homolog 1; mothers against DPP homolog 5; Mothers-against-DPP-related 1; mSmad5; OTTHUMP00000223331; SMA- and MAD-related protein 5; SMAD; SMAD 1; SMAD 5; SMAD family member 1; SMAD family member 5; SMAD, mothers against DPP homolog 1; SMAD, mothers against DPP homolog 5; TGF-beta signaling protein 1; transforming growth factor-beta signaling protein 1; Transforming growth factor-beta-signaling protein 1

View more View less

Gene Aliases: 1110051M15Rik; AI451355; AI528653; BSP-1; BSP1; Dwf-C; DWFC; JV4-1; JV41; JV5-1; Mad1; MADH1; MADH5; MADR1; Mlp1; Msmad5; MusMLP; SMAD1; SMAD5

View more View less

UniProt ID: (Human) Q15797, (Human) Q99717, (Mouse) P70340, (Rat) P97588, (Mouse) P97454, (Rat) Q9R1V3

View more View less

Entrez Gene ID: (Human) 4086, (Human) 4090, (Mouse) 17125, (Rat) 25671, (Mouse) 17129, (Rat) 59328

View more View less

Function(s)
RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II core promoter sequence-specific DNA binding transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding transcription factor activity, sequence-specific DNA binding receptor signaling protein activity protein binding protein kinase binding transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity identical protein binding protein homodimerization activity metal ion binding protein heterodimerization activity co-SMAD binding I-SMAD binding ubiquitin protein ligase binding DNA binding
Process(es)
ureteric bud development Mullerian duct regression osteoblast fate commitment transcription, DNA-templated protein phosphorylation signal transduction transforming growth factor beta receptor signaling pathway germ cell development embryonic pattern specification erythrocyte differentiation BMP signaling pathway positive regulation of osteoblast differentiation positive regulation of transcription, DNA-templated cartilage development cardiac muscle contraction bone development SMAD protein signal transduction cellular response to organic cyclic compound positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus angiogenesis regulation of transcription, DNA-templated multicellular organism development cell differentiation positive regulation of transcription from RNA polymerase II promoter cellular response to BMP stimulus MAPK cascade mesodermal cell fate commitment transcription from RNA polymerase II promoter inflammatory response SMAD protein complex assembly gamete generation negative regulation of cell proliferation positive regulation of gene expression midbrain development hindbrain development primary miRNA processing homeostatic process cardiac muscle cell proliferation positive regulation of cartilage development regulation of transcription from RNA polymerase II promoter response to drug positive regulation of cell differentiation kidney development response to organonitrogen compound negative regulation of muscle cell apoptotic process wound healing positive regulation of dendrite morphogenesis ossification regulation of ossification
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support