Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • NME1 Antibodies

Invitrogen

NME1 Polyclonal Antibody

View all (121) NME1 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite NME1 Polyclonal Antibody

  • Antibody Testing Data (3)
NME1 Antibody in Western Blot (WB)
Group 53 Created with Sketch.
NME1 Antibody in Western Blot (WB)
Group 53 Created with Sketch.

FIGURE: 1 / 3

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

NME1 Antibody (PA5-79743) in WB

Western blot analysis of NME1 using NME1 Polyclonal Antibody (Product # PA5-79743). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: rat brain tissue lysates. Lane 2: rat liver tissue lysates. Lane 3: rat lung tissue lysates. Lane 4: rat C6 whole cell lysates. Lane 5: mouse brain tissue lysates. Lane 6: mouse liver tissue lysates. Lane 7: mouse lung tissue lysates. Lane 8: mouse NIH/3... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

NME1 Antibody in Western Blot (WB)
NME1 Antibody in Western Blot (WB)
NME1 Antibody in Flow Cytometry (Flow)
NME1 Polyclonal Antibody

Product Details

PA5-79743

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746858

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Hela whole cell, human A431 whole cell, human HepG2 whole cell, human K562 whole cell, human MCF-7 whole cell, human A375 whole cell, human MOLT-4 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat C6 whole cell, mouse brain tissue, mouse liver tissue, mouse lung tissue, mouse NIH/3T3 whole cell. Flow: HEL cell.

Target Information

NME1 was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in the gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: expressed in non-metastatic cells 1 protein; expressed in non-metastatic cells 1 protein (NM23A) (nucleoside diphosphate kinase); expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); GAAD; Granzyme A activated DNase (GAAD); Granzyme A-activated DNase; GZMA activated DNase; included; Metastasis inhibition factor NM23; NDK A; NDP kinase A; NDP kinase beta; NDPK-A; NM23-H1; nm23-M1; NM23H1B; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; Nucleoside diphosphate kinase A; nucleoside-diphosphate kinase 1; nucleotide diphosphate kinase; nucloside diphosphate kinase; Tumor metastatic process-associated protein

View more View less

Gene Aliases: AL024257; AWD; GAAD; NB; NBS; NDKA; NDPK-A; NDPKA; NM23; NM23-H1; NM23-M1; NM23A; NME1

View more View less

UniProt ID: (Human) P15531, (Mouse) P15532, (Rat) Q05982

View more View less

Entrez Gene ID: (Human) 4830, (Mouse) 18102, (Rat) 191575

View more View less

Function(s)
magnesium ion binding RNA polymerase II regulatory region sequence-specific DNA binding single-stranded DNA binding deoxyribonuclease activity nucleoside diphosphate kinase activity protein binding ATP binding GTP binding intermediate filament binding protein kinase binding identical protein binding gamma-tubulin binding ribosomal small subunit binding poly(A) RNA binding nucleotide binding kinase activity transferase activity enzyme binding metal ion binding
Process(es)
negative regulation of myeloid leukocyte differentiation purine nucleotide metabolic process nucleoside diphosphate phosphorylation GTP biosynthetic process pyrimidine nucleotide metabolic process UTP biosynthetic process CTP biosynthetic process DNA metabolic process endocytosis lactation negative regulation of cell proliferation nucleoside triphosphate biosynthetic process negative regulation of gene expression positive regulation of neuron projection development response to amine nucleobase-containing small molecule interconversion hippocampus development response to testosterone cellular response to drug regulation of apoptotic process positive regulation of DNA binding positive regulation of epithelial cell proliferation response to cAMP cellular response to glucose stimulus cellular response to fatty acid nervous system development nucleotide metabolic process phosphorylation cell differentiation mammary gland development nucleic acid phosphodiester bond hydrolysis DNA catabolic process integrin-mediated signaling pathway response to drug negative regulation of apoptotic process positive regulation of keratinocyte differentiation positive regulation of transcription from RNA polymerase II promoter
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-7887d5bf67-gxz2v:80/100.66.128.142:80.
git-commit: 1c5b77651f08bdd3ffd11596e5fe4ce144025943
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0