Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • LIMK1 Antibodies

Invitrogen

LIMK1 Polyclonal Antibody

1 Reference
View all (58) LIMK1 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite LIMK1 Polyclonal Antibody

  • Antibody Testing Data (1)
LIMK1 Antibody in Western Blot (WB)
Group 53 Created with Sketch.
LIMK1 Antibody in Western Blot (WB)
Group 53 Created with Sketch.

FIGURE: 1 / 1

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

LIMK1 Antibody (PA5-79603) in WB

Western blot analysis of LIMK1 in Lane 1: rat brain tissue lysate, Lane 2: mouse gastric tissue lysate, Lane 3: HeLa whole cell lysate, Lane 4: U87 whole cell lysate, Lane 5: SKOV whole cell lysate using 40-50 µg per well. Sample was incubated with LIMK1 (Product # PA5-79603) at a dilution of 0.5 µg/mL. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

LIMK1 Antibody in Western Blot (WB)
LIMK1 Polyclonal Antibody

Product Details

PA5-79603

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
View 1 publication 1 publication
Product Specifications

Species Reactivity

Human, Mouse, Rat

Published species

Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746718

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: Rat Brain Tissue, Mouse Gaster Tissue, HELA whole cell, U87 whole cell, SKOV whole cell.

Target Information

LIMK1 is a serine/threonine kinase involved in regulation of actin cytoskeletal changes via phosphorylation of cofilin. LIMK1 has also been implicated in brain development. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: EC 2.7.11.1; kinase LIMK1; KIZ-1; LIM domain kinase 1; lim kinase 1; LIM motif-containing protein kinase; LIM motif-containing protein kinase 1; LIM-domain containing protein kinase 1; LIM-domain containing, protein kinase 1; LIMK-1

View more View less

Gene Aliases: KIZ-1; LIMK; LIMK-1; LIMK1

View more View less

UniProt ID: (Human) P53667, (Mouse) P53668

View more View less

Entrez Gene ID: (Human) 3984, (Mouse) 16885, (Rat) 65172

View more View less

Function(s)
protein kinase activity protein serine/threonine kinase activity protein binding ATP binding zinc ion binding heat shock protein binding protein heterodimerization activity
Process(es)
protein phosphorylation signal transduction Rho protein signal transduction nervous system development actin cytoskeleton organization positive regulation of actin filament bundle assembly Fc-gamma receptor signaling pathway involved in phagocytosis positive regulation of axon extension negative regulation of ubiquitin-protein transferase activity positive regulation of stress fiber assembly
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-7887d5bf67-gxz2v:80/100.66.128.142:80.
git-commit: 1c5b77651f08bdd3ffd11596e5fe4ce144025943
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0