Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • LCAT Antibodies

Invitrogen

LCAT Polyclonal Antibody

View all (14) LCAT antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite LCAT Polyclonal Antibody

  • Antibody Testing Data (1)
LCAT Antibody in Western Blot (WB)
Group 53 Created with Sketch.
LCAT Antibody in Western Blot (WB)
Group 53 Created with Sketch.

FIGURE: 1 / 1

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

LCAT Antibody (PA5-95296) in WB

Western blot analysis of LCAT in Lane 1: rat brain tissue lysate (50 µg), Lane 2: mouse testis tissue lysate (50 µg), Lane 3: HEPG2 whole cell lysate (40 µg), Lane 4: HeLa whole cell lysate (40 µg). Samples were incubated with LCAT polyclonal antibody (Product # PA5-95296). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

LCAT Antibody in Western Blot (WB)
LCAT Polyclonal Antibody

Product Details

PA5-95296

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2807100

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: Rat Brain Tissue, Mouse Testis Tissue, HEPG2 whole cell, HELA whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

Lecithin: cholesterol acyltransferase (LCAT) is the plasma enzyme responsible for most HDL cholesteryl esters in human plasma. In species with cholesteryl ester transfer protein (CETP) it is also responsible for a significant proportion of VLDL and LDL cholesteryl esters. LCAT, through the esterification of cholesterol, plays a role in the reverse cholesterol transport pathway by facilitating the net movement of cholesterol from peripheral tissues back to the liver for excretion. LCAT deficiency results in low levels of plasma HDL, whereas a transgenic overexpression of LCAT results in increased plasma HDL concentrations.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: 1-alkyl-2-acetylglycerophosphocholine esterase; Lecithin-cholesterol acyltransferase; lecithin-cholesterol acyltransferase Lcat; PAF acetylhydrolase; phosphatidylcholine--sterol O-acyltransferase; Phosphatidylcholine-sterol acyltransferase; Phospholipid-cholesterol acyltransferase; Platelet-activating factor acetylhydrolase; testicular secretory protein Li 24

View more View less

Gene Aliases: AI046659; D8Wsu61e; LCAT

View more View less

UniProt ID: (Human) P04180, (Rat) P18424, (Mouse) P16301

View more View less

Entrez Gene ID: (Human) 3931, (Rat) 24530, (Mouse) 16816

View more View less

Function(s)
phosphatidylcholine-sterol O-acyltransferase activity phospholipase A2 activity protein binding apolipoprotein A-I binding O-acyltransferase activity transferase activity transferase activity, transferring acyl groups
Process(es)
phospholipid metabolic process phosphatidylcholine biosynthetic process cholesterol metabolic process cholesterol transport very-low-density lipoprotein particle remodeling high-density lipoprotein particle remodeling cholesterol esterification lipoprotein metabolic process lipoprotein biosynthetic process cholesterol homeostasis reverse cholesterol transport response to copper ion response to glucocorticoid regulation of high-density lipoprotein particle assembly phosphatidylcholine metabolic process lipid metabolic process steroid metabolic process
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-55c564d944-rwwh4:80/100.66.128.142:80.
git-commit: 3092084cb0e494f0e07f07633350183de7fa10a8
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0