Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • EpCAM (CD326) Antibodies

Invitrogen

EpCAM (CD326) Polyclonal Antibody

Advanced Verification
View all (272) EpCAM (CD326) antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite EpCAM (CD326) Polyclonal Antibody

  • Antibody Testing Data (6)
  • Advanced Verification (1)
EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.
EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.

FIGURE: 1 / 7

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

EpCAM (CD326) Antibody (PA5-79207) in IHC (P)

Immunohistochemistry (Paraffin) analysis of EpCAM (CD326) in paraffin-embedded section of human colon cancer tissue using EpCAM (CD326) Polyclonal Antibody (Product # PA5-79207). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 2 µg/mL dil... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
EpCAM (CD326) Antibody in Western Blot (WB)
EpCAM (CD326) Antibody in Western Blot (WB)
EpCAM (CD326) Antibody in Flow Cytometry (Flow)
EpCAM (CD326) Antibody
EpCAM (CD326) Polyclonal Antibody

Product Details

PA5-79207

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-

ELISA (ELISA)

0.1-0.5 µg/mL
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746323

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human CACO-2 whole cell, human MCF-7 whole cell. IHC: human colon cancer tissue. Flow: CACO-2 cell.

Target Information

Ep-CAM (epithelial adhesion molecule, epithelial specific antigen, ESA) is a transmembrane glycoprotein expressed in the epithelium with a molecular weight of approximately 40 kDa, which functions as an epithelial cell adhesion molecule. Ep-CAM functions as a homotypic calcium-independent cell adhesion molecule, and has a direct impact on cell cycle, proliferation and metabolism of epithelial cells and fibroblasts due to its ability to rapidly induce the proto-oncogene c-myc and the cell cycle regulating genes cyclin A and E. Ep-CAM mediates Ca2+-independent homotypic interactions. Formation of Ep-CAM-mediated adhesions have a negative regulatory effect on adhesions mediated by classic cadherins, which may have strong effects on the differentiation and growth of epithelial cells. Ep-CAM overexpression was suggested to be associated with enhanced epithelial proliferation. Ep-CAM is highly expressed in human carcinomas, and is a marker for tumors of epithelial lineage. Ep-CAM is expressed on baso-lateral cell surface in most simple epithelia and many carcinoma types. Also, Ep-CAM reportedly distinguishes adenocarcinomas from pleural mesotheliomas.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Adenocarcinoma-associated antigen; CD326; Cell surface glycoprotein Trop-1; EGP; EGP314; Ep-CAM; Epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein; Epithelial glycoprotein 314; hEGP314; human epithelial glycoprotein-2; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); Tumor-associated calcium signal transducer 1

View more View less

Gene Aliases: DIAR5; EGP-2; EGP314; EGP40; EPCAM; ESA; GA733-2; HNPCC8; KS1/4; KSA; M1S2; M4S1; MIC18; MK-1; TACSTD1; TROP1

View more View less

UniProt ID: (Human) P16422

View more View less

Entrez Gene ID: (Human) 4072

View more View less

Function(s)
protein binding protein complex binding cadherin binding involved in cell-cell adhesion
Process(es)
ureteric bud development positive regulation of cell proliferation signal transduction involved in regulation of gene expression negative regulation of apoptotic process positive regulation of transcription from RNA polymerase II promoter stem cell differentiation cell-cell adhesion negative regulation of cell-cell adhesion mediated by cadherin positive regulation of cell motility positive regulation of stem cell proliferation
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-55c564d944-rwwh4:80/100.66.128.142:80.
git-commit: 3092084cb0e494f0e07f07633350183de7fa10a8
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0