Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • DC-SIGN (CD209) Antibodies

Invitrogen

DC-SIGN (CD209) Polyclonal Antibody

4 Published Figures
2 References
View all (52) DC-SIGN (CD209) antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite DC-SIGN (CD209) Polyclonal Antibody

  • Antibody Testing Data (1)
  • Published Figures (4)
DC-SIGN (CD209) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.
DC-SIGN (CD209) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.

FIGURE: 1 / 5

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

DC-SIGN (CD209) Antibody (PA5-78968) in IHC (P)

Immunohistochemistry analysis of DC-SIGN (CD209) on paraffin-embedded human intestinal cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with DC-SIGN (CD209) polyclonal antibody (Product# PA5-78968) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit Ig... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

DC-SIGN (CD209) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
DC-SIGN (CD209) Antibody in Immunohistochemistry (IHC)
DC-SIGN (CD209) Antibody in Immunohistochemistry (IHC)
DC-SIGN (CD209) Antibody in Flow Cytometry (Flow)
DC-SIGN (CD209) Antibody in Flow Cytometry (Flow)
DC-SIGN (CD209) Polyclonal Antibody

Product Details

PA5-78968

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (IHC)

-
View 1 publication 1 publication

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
View 1 publication 1 publication
Product Specifications

Species Reactivity

Human

Published species

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746084

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human HepG2 whole cell. IHC: human intestinal cancer tissue, human placenta tissue. Flow: THP-1 cell.

Target Information

This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; CD209; CD209 antigen; DC-SIGN; Dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; HIV gpl20-binding protein; MGC129965; MGC130443

View more View less

Gene Aliases: CD209; CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1

View more View less

UniProt ID: (Human) Q9NNX6

View more View less

Entrez Gene ID: (Human) 30835

View more View less

Function(s)
virus receptor activity protein binding mannose binding carbohydrate binding peptide antigen binding virion binding metal ion binding
Process(es)
stimulatory C-type lectin receptor signaling pathway adaptive immune response endocytosis heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules leukocyte cell-cell adhesion cell-cell recognition modulation by virus of host morphology or physiology virion attachment to host cell viral genome replication antigen processing and presentation intracellular signal transduction regulation of T cell proliferation innate immune response viral entry into host cell peptide antigen transport intracellular transport of virus
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0