Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • BMP-2 Antibodies

Invitrogen

BMP-2 Polyclonal Antibody

1 Reference
View all (49) BMP-2 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite BMP-2 Polyclonal Antibody

  • Antibody Testing Data (3)
Group 53 Created with Sketch.
Group 53 Created with Sketch.

FIGURE: 1 / 3

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

{{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

BMP-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
BMP-2 Antibody in Western Blot (WB)
BMP-2 Antibody in ELISA (ELISA)
BMP-2 Polyclonal Antibody

Product Details

PA5-78874

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (IHC)

-
View 1 publication 1 publication

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

ELISA (ELISA)

1-5 µg/mL
-
Product Specifications

Species Reactivity

Human, Rat

Published species

Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2745990

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: Rat Lung Tissue, Rat Brain Tissue, U87 whole cell, HELA whole cell. IHC: human intestinal cancer tissue.

Target Information

Bone Morphogenic Proteins (BMP) are members of the TGF-beta superfamily that affect bone and cartilage formation (Hogan 1996, Reddi 1998 and Francis-West et al. 1999). Mature BMPs are 30-38 kDa proteins that assume a TGF-beta -like cysteine knot configuration. Lovostatin increases bone formation by turning on the bmp-2 gene (Mundy et al. 1999). BMPs stimulate the production of specific bone matrix proteins and alter stromal cell and osteoclast proliferation (Macias et al. 1999, Lecanda et al. 1997). BMPs may also be an important factor for development of the viscera, with roles in cell proliferation, apoptosis, differentiation, and morphogenesis (Hogan 1996, Dale and Wardle 1999). BMPs appear to be responsible for normal dorsal/ventral patterning. Like TGF-beta, BMPs bind to a type II receptor, which then recruits the transducing type I receptor unit, activating the Smad protein signaling pathway (Massague 1994, Derynck 1997, Attisano 1993).

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: 2610024H22Rik; AL117858; AW546137; BB189135; BMP; BMP-2; BMP-2A; BMPR-II; BMPRII; Bone morphogenetic; Bone morphogenetic protein; Bone morphogenetic protein 2; Bone morphogenetic protein 2A; H-BMP-2

View more View less

Gene Aliases: BDA2; Bmp-2; BMP2; BMP2A

View more View less

UniProt ID: (Human) P12643, (Rat) P49001

View more View less

Entrez Gene ID: (Human) 650, (Rat) 29373

View more View less

Function(s)
retinol dehydrogenase activity receptor binding cytokine activity transforming growth factor beta receptor binding protein binding growth factor activity phosphatase activator activity co-receptor binding SMAD binding protein heterodimerization activity BMP receptor binding protein domain specific binding protein homodimerization activity
Process(es)
negative regulation of transcription from RNA polymerase II promoter activation of MAPK activity skeletal system development osteoblast differentiation branching involved in ureteric bud morphogenesis response to hypoxia in utero embryonic development epithelial to mesenchymal transition positive regulation of protein phosphorylation positive regulation of endothelial cell proliferation chondrocyte differentiation BMP signaling pathway involved in heart induction atrioventricular valve morphogenesis endocardial cushion morphogenesis negative regulation of Wnt signaling pathway involved in heart development proteoglycan metabolic process regulation of transcription, DNA-templated protein phosphorylation inflammatory response Notch signaling pathway cell-cell signaling heart development negative regulation of cell proliferation embryo development organ morphogenesis positive regulation of gene expression positive regulation of epithelial to mesenchymal transition positive regulation of pathway-restricted SMAD protein phosphorylation negative regulation of steroid biosynthetic process positive regulation of phosphatase activity telencephalon development telencephalon regionalization positive regulation of Wnt signaling pathway bone mineralization positive regulation of cell migration positive regulation of bone mineralization BMP signaling pathway protein destabilization positive regulation of protein binding negative regulation of aldosterone biosynthetic process positive regulation of osteoblast proliferation cardiocyte differentiation embryonic heart tube anterior/posterior pattern specification bone mineralization involved in bone maturation growth odontogenesis of dentin-containing tooth positive regulation of odontogenesis regulation of odontogenesis of dentin-containing tooth positive regulation of apoptotic process positive regulation of MAPK cascade negative regulation of insulin-like growth factor receptor signaling pathway cell fate commitment positive regulation of fat cell differentiation positive regulation of neuron differentiation positive regulation of osteoblast differentiation positive regulation of ossification negative regulation of cell cycle negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter positive regulation of astrocyte differentiation mesenchymal cell differentiation inner ear development negative regulation of calcium-independent cell-cell adhesion cardiac muscle cell differentiation cardiac muscle tissue morphogenesis oxidation-reduction process pericardium development corticotropin hormone secreting cell differentiation thyroid-stimulating hormone-secreting cell differentiation cardiac epithelial to mesenchymal transition pathway-restricted SMAD protein phosphorylation SMAD protein signal transduction mesenchyme development positive regulation of Wnt signaling pathway by BMP signaling pathway positive regulation of cartilage development positive regulation of ERK1 and ERK2 cascade cellular response to organic cyclic compound cellular response to BMP stimulus mesenchymal cell proliferation involved in ureteric bud development negative regulation of canonical Wnt signaling pathway positive regulation of p38MAPK cascade positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus negative regulation of cortisol biosynthetic process negative regulation of cardiac muscle cell differentiation ossification response to mechanical stimulus negative regulation of gene expression response to retinoic acid ovulation cycle regulation of apoptotic process regulation of MAPK cascade positive regulation of cell differentiation positive regulation of neurogenesis cartilage development cellular response to mechanical stimulus cellular response to growth factor stimulus
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-55c564d944-rwwh4:80/100.66.128.142:80.
git-commit: 3092084cb0e494f0e07f07633350183de7fa10a8
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0