Disclaimer

Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

  • Primary Antibodies ›
  • Aquaporin 2 Antibodies

Invitrogen

Aquaporin 2 Polyclonal Antibody

View all (30) Aquaporin 2 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Cite Aquaporin 2 Polyclonal Antibody

  • Antibody Testing Data (5)
Aquaporin 2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.
Aquaporin 2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Group 53 Created with Sketch.

FIGURE: 1 / 5

{{ $ctrl.currentElement.advancedVerification.fullName }}
{{ $ctrl.currentElement.advancedVerification.text }}

Aquaporin 2 Antibody (PA5-78809) in IHC (P)

Immunohistochemistry analysis of Aquaporin 2 on paraffin-embedded human renal cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with Aquaporin 2 polyclonal antibody (Product# PA5-78809) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
Published figure supplied by benchsci-logo
PMID: {{$ctrl.currentElement.benchSciPubmedId}}
View Product

{{$ctrl.videoDesc}}

{{$ctrl.videoLongDesc}}

Aquaporin 2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Aquaporin 2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Aquaporin 2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
Aquaporin 2 Antibody in Western Blot (WB)
Aquaporin 2 Antibody in Flow Cytometry (Flow)
Aquaporin 2 Polyclonal Antibody

Product Details

PA5-78809

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2745925

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: rat kidney tissue, rat NRK whole cell, rat PC-12 whole cell, mouse kidney tissue, mouse HBZY whole cell, mouse RAW2647 whole cell. IHC: Mouse Kidney tissue, Rat Kidney tissue, Human Renal Cancer tissue. Flow: PC-3 cell.

Target Information

Aquaporin 2 (AQP2) is a hormonally regulated water channel located in the renal collecting duct. Mutations in the AQP2 gene cause hereditary nephrogenic diabetes insipidus in humans. A vasopressin induced cAMP increase results in the phosphorylation of AQP2 at serine-256 and its translocation from the intracellular vesicles to the apical membrane of principal cells. Recently, serine-261 has been identified as a novel phosphorylation site on AQP2 and levels of phosphorylated S261 have been shown to decrease with vasopressin treatment suggesting its involvement in vasopressin-dependent AQP2 trafficking.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: ADH water channel; AQP 2; AQP CD; AQP-2; AQP-CD; AQPCD; aquaporin 2 (collecting duct); Aquaporin CD; Aquaporin-2; Aquaporin-CD; Aquaporin2; Aquaporine 2; Collecting duct water channel protein; MGC34501; Water channel protein for renal collecting duct; water-channel aquaporin 2; WCH CD; WCH-CD; WCHCD

View more View less

Gene Aliases: AQP-2; AQP-CD; AQP2; aquaporin-2; cph; jpk; WCH-CD

View more View less

UniProt ID: (Human) P41181, (Mouse) P56402, (Rat) P34080

View more View less

Entrez Gene ID: (Human) 359, (Mouse) 11827, (Rat) 25386

View more View less

Function(s)
water transmembrane transporter activity glycerol transmembrane transporter activity water channel activity glycerol channel activity actin binding transporter activity PDZ domain binding protein binding
Process(es)
renal water homeostasis renal water transport water transport excretion cellular water homeostasis glycerol transport ion transmembrane transport cellular response to water deprivation cellular response to copper ion cellular response to mercury ion metanephric collecting duct development transport cell volume homeostasis apoptotic process actin filament depolymerization carbohydrate transmembrane transport positive regulation of calcium ion transport transmembrane transport hyperosmotic response female pregnancy aging response to water deprivation response to salt stress response to hormone response to lithium ion water homeostasis response to lipopolysaccharide response to glucagon response to starvation response to calcium ion
It has to be done as per old AB suggested Products section.
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support

Your items have has been added!


Host server : magellan-search-649bfd9c6b-jlsz7:80/100.66.128.142:80.
git-commit: 6001d82975f0049f9efc09ec70b1b2d89229eeb3
git-url: https://github.com/thermofisher/magellan-search
git-branch: release/2.36.2-2025.09.39-1.0